NavAb NormoPP mutant. Determined by X-ray diffraction at 2.52 Å resolution. Released 16 May 2018.
Explore 6C1M in 3D Show helices and sheets RCSB PDB PDBe
6C1M contains 34 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 1002-1009 | 8 | |
| α-helix | 1012-1031 | 20 | |
| α-helix | 1035-1040 | 6 | |
| α-helix | 1042-1067 | 26 | |
| α-helix | 1068-1073 | 6 | |
| α-helix | 1075-1086 | 12 | |
| α-helix | 1097-1101 | 5 | |
| α-helix | 1102-1107 | 6 | |
| α-helix | 1108-1112 | 5 | |
| α-helix | 1116-1125 | 10 | |
| α-helix | 1128-1130 | 3 | |
| α-helix | 1131-1152 | 22 | |
| α-helix | 1157-1160 | 4 | |
| α-helix | 1163-1175 | 13 | |
| α-helix | 1179-1184 | 6 | |
| α-helix | 1185-1188 | 4 | |
| α-helix | 1195-1220 | 26 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 2001-2009 | 9 | |
| α-helix | 2012-2031 | 20 | |
| α-helix | 2035-2040 | 6 | |
| α-helix | 2042-2067 | 26 | |
| α-helix | 2068-2073 | 6 | |
| α-helix | 2075-2086 | 12 | |
| α-helix | 2097-2101 | 5 | |
| α-helix | 2102-2107 | 6 | |
| α-helix | 2108-2112 | 5 | |
| α-helix | 2116-2125 | 10 | |
| α-helix | 2128-2130 | 3 | |
| α-helix | 2131-2152 | 22 | |
| α-helix | 2157-2160 | 4 | |
| α-helix | 2163-2174 | 12 | |
| α-helix | 2179-2184 | 6 | |
| α-helix | 2185-2190 | 6 | |
| α-helix | 2195-2220 | 26 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Ion transport protein | A, B | protein | 285 | Arcobacter butzleri (strain RM4018) | A8EVM5 (AlphaFold model) |
>6C1M_1 Ion transport protein (chains A, B) MDYKDDDDKGSLVPRGSHMYLRITNIVESSFFTKFIIYLIVLNGITMGLETSKTFMQSFG VYTTLFNQIVITIFTIEIILRIYVHRISFFKDPWSLFDFFVVAISLVPTSSGFEILRVLG VLRLFRLVTAVPQMRKIVSALISVIPGMLSVIALMTLFFYIFAIMATQLFGERFPEWFGT LGESFYTLFQVMTLESWSMGIVRPLMEVYPYAWVFFIPFIFVVTFVMINLVVAICVDAMA ILNQKEEQHIIDEVQSHEDNINNEIIKLREEIVELKELIKTSLKN
| ID | Name | Formula | Copies |
|---|---|---|---|
| PX4 | 1,2-dimyristoyl-sn-glycero-3-phosphocholine | C36 H73 N O8 P | 15 |
| MGX | 1-methylguanidine | C2 H7 N3 | 2 |
| 1N7 | Chapso | C32 H59 N2 O8 S | 8 |
Water and common crystallization additives (NA, SO4) are not listed.
Structural basis for gating pore current in periodic paralysis. Jiang, D., Gamal El-Din, T.M., Ing, C. et al. Nature (2018) 557:590-594. DOI 10.1038/s41586-018-0120-4 · PubMed
Other PDB entries of the same protein (UniProt A8EVM5 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6C1M directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.