Crystal Structure of DH270.3 Fab in complex with Man9. Determined by X-ray diffraction at 2.85 Å resolution. Released 21 Feb 2018.
Explore 6CBJ in 3D Show helices and sheets RCSB PDB PDBe
6CBJ contains 21 α-helices and 47 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-6 | 4 | 1 |
| α-helix | 7-9 | 3 | |
| β-strand | 10-12 | 3 | 2 |
| β-strand | 18-25 | 8 | 1 |
| α-helix | 29-31 | 3 | |
| β-strand | 32-39 | 8 | 2 |
| β-strand | 45-51 | 7 | 2 |
| β-strand | 58-59 | 2 | 2 |
| α-helix | 62-64 | 3 | |
| β-strand | 68-73 | 6 | 1 |
| β-strand | 78-83 | 6 | 1 |
| α-helix | 88-90 | 3 | |
| β-strand | 92-101 | 10 | 2 |
| α-helix | 102 | 1 | |
| β-strand | 116-117 | 2 | 2 |
| β-strand | 118 | 1 | 1 |
| β-strand | 121-125 | 5 | 2 |
| α-helix | 129-130 | 2 | |
| β-strand | 131 | 1 | 3 |
| α-helix | 132-133 | 2 | |
| β-strand | 134-138 | 5 | 4 |
| β-strand | 149-159 | 11 | 4 |
| β-strand | 160 | 1 | 3 |
| β-strand | 165-168 | 4 | 5 |
| α-helix | 169-171 | 3 | |
| β-strand | 173 | 1 | 5 |
| β-strand | 177-179 | 3 | 4 |
| α-helix | 180-182 | 3 | |
| β-strand | 183-184 | 2 | 4 |
| β-strand | 190-199 | 10 | 4 |
| α-helix | 200-202 | 3 | |
| α-helix | 207 | 1 | |
| β-strand | 208-214 | 7 | 5 |
| α-helix | 215-217 | 3 | |
| β-strand | 219-225 | 7 | 5 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4 | 1 | 6 |
| β-strand | 5 | 1 | 7 |
| β-strand | 9-12 | 4 | 8 |
| β-strand | 18-23 | 6 | 7 |
| β-strand | 35-40 | 6 | 8 |
| α-helix | 45-46 | 2 | |
| β-strand | 47-51 | 5 | 8 |
| β-strand | 55-56 | 2 | 8 |
| α-helix | 57 | 1 | |
| β-strand | 64-69 | 6 | 7 |
| β-strand | 72-77 | 6 | 7 |
| α-helix | 82-84 | 3 | |
| β-strand | 87-93 | 7 | 8 |
| β-strand | 99-101 | 3 | 8 |
| β-strand | 102 | 1 | 6 |
| β-strand | 105-109 | 5 | 8 |
| α-helix | 112-114 | 3 | |
| β-strand | 115 | 1 | 9 |
| α-helix | 116-117 | 2 | |
| β-strand | 118-122 | 5 | 10 |
| α-helix | 123-125 | 3 | |
| α-helix | 126-130 | 5 | |
| β-strand | 134-143 | 10 | 10 |
| β-strand | 144 | 1 | 9 |
| β-strand | 149-154 | 6 | 11 |
| β-strand | 157-159 | 3 | 11 |
| β-strand | 165 | 1 | 10 |
| α-helix | 166-168 | 3 | |
| β-strand | 169-170 | 2 | 10 |
| β-strand | 176-184 | 9 | 10 |
| α-helix | 186-190 | 5 | |
| β-strand | 195-201 | 7 | 11 |
| β-strand | 204-210 | 7 | 11 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| DH270.3 Fab heavy chain | H | protein | 238 | Homo sapiens | S6C4S0 (AlphaFold model) |
| DH270.3 Fab light chain | L | protein | 216 | Homo sapiens | Q6PJG0 (AlphaFold model) |
>6CBJ_1 DH270.3 Fab heavy chain (chains H) QVQLVQSGAELKKPGASVKVSCKASGYTLSDYYVHWLRQAPGQGLEWVAWINPTSGRTIS PRKFQGRVTMTTDTSMNVAYMELRGLRSDDTAVYFCARGGWISLYVDYSYYPNFDSWGQG TLVSVSGASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTF PAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKHHHHHH
>6CBJ_2 DH270.3 Fab light chain (chains L) QPVLTQPASVSGSPGQSITISCTGSSSDVGSYNLVSWYQQHPGKAPKLMIYEVNKWASGV SDRFAGSKSGNTASLTISRLQAEDEANYFCSSSTNSATVIFGGGTKLTVLGQPKGAPSVT LFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASS YLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
| ID | Name | Formula | Copies |
|---|---|---|---|
| PO4 | Phosphate ion | O4 P | 1 |
HIV envelope V3 region mimic embodies key features of a broadly neutralizing antibody lineage epitope. Fera, D., Lee, M.S., Wiehe, K. et al. Nat Commun (2018) 9:1111-1111. DOI 10.1038/s41467-018-03565-6 · PubMed
Other PDB entries of the same protein (UniProt S6C4S0 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6CBJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.