Crystal structure MBD3 MBD domain in complex with methylated CpG DNA. Determined by X-ray diffraction at 1.9 Å resolution. Released 9 May 2018.
Explore 6CCG in 3D Show helices and sheets RCSB PDB PDBe
6CCG contains 2 α-helices and 14 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-7 | 4 | 1 |
| β-strand | 16-21 | 6 | 1 |
| β-strand | 25 | 1 | 2 |
| β-strand | 31-36 | 6 | 1 |
| β-strand | 42-43 | 2 | 1 |
| α-helix | 46-53 | 8 | |
| β-strand | 62-63 | 2 | 3 |
| β-strand | 68-69 | 2 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-7 | 4 | 4 |
| β-strand | 16-21 | 6 | 4 |
| β-strand | 24 | 1 | 2 |
| β-strand | 31-36 | 6 | 4 |
| β-strand | 42-43 | 2 | 4 |
| α-helix | 46-53 | 8 | |
| β-strand | 62-63 | 2 | 5 |
| β-strand | 68-69 | 2 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Methyl-CpG-binding domain protein 3 | A, B | protein | 73 | Homo sapiens | O95983 (AlphaFold model) |
| DNA | C, D, E, F | DNA | 12 | synthetic construct |
>6CCG_1 Methyl-CpG-binding domain protein 3 (chains A, B) GSMERKRWECPALPQGWEREEVPRRSGLSAGHRDVFYYSPSGKKFRSKPQLARYLGGSMD LSTFDFRTGKMLM
>6CCG_2 DNA (chains C, D, E, F) GCCAGCGCTGGC
Structural analyses reveal that MBD3 is a methylated CG binder. Liu, K., Lei, M., Wu, Z. et al. FEBS J (2019) 286:3240-3254. DOI 10.1111/febs.14850 · PubMed
Other PDB entries of the same protein (UniProt O95983 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6CCG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.