Crystal structure of ferrous form of the Cl-Tyr157 human cysteine dioxygenase with both uncrosslinked and crosslinked cofactor. Determined by X-ray diffraction at 1.82 Å resolution. Released 4 Jul 2018.
Explore 6CDH in 3D Show helices and sheets RCSB PDB PDBe
6CDH contains 8 α-helices and 14 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 12-22 | 11 | |
| α-helix | 30-39 | 10 | |
| α-helix | 44-47 | 4 | |
| α-helix | 48-50 | 3 | |
| β-strand | 59-64 | 6 | 1 |
| α-helix | 66-68 | 3 | |
| β-strand | 71-77 | 7 | 1 |
| β-strand | 82 | 1 | 2 |
| α-helix | 83-84 | 2 | |
| β-strand | 85-86 | 2 | 2 |
| β-strand | 92-99 | 8 | 1 |
| β-strand | 102-107 | 6 | 2 |
| α-helix | 108-110 | 3 | |
| β-strand | 119-125 | 7 | 2 |
| α-helix | 126 | 1 | |
| β-strand | 130-133 | 4 | 1 |
| β-strand | 139-144 | 6 | 2 |
| β-strand | 151-158 | 8 | 1 |
| β-strand | 163-167 | 5 | 2 |
| β-strand | 174-178 | 5 | 2 |
| β-strand | 183-184 | 2 | 1 |
| β-strand | 187-188 | 2 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Cysteine dioxygenase type 1 | A | protein | 200 | Homo sapiens | Q16878 (AlphaFold model) |
>6CDH_1 Cysteine dioxygenase type 1 (chains A) SEQTEVLKPRTLADLIRILHQLFAGDEVNVEEVQAIMEAYESDPTEWAMYAKFDQYRYTR NLVDQGNGKFNLMILCWGEGHGSSIHDHTNSHCFLKMLQGNLKETLFAWPDKKSNEMVKK SERVLRENQCAYINDSVGLHRVENISHTEPAVSLHLXSPPFDTCHAFDQRTGHKNKVTMT FHSKFGIRTPNATSGSLENN
| ID | Name | Formula | Copies |
|---|---|---|---|
| FE2 | FE (II) ion | Fe | 1 |
Water and common crystallization additives (GOL, SO4) are not listed.
Cleavage of a carbon-fluorine bond by an engineered cysteine dioxygenase. Li, J., Griffith, W.P., Davis, I. et al. Nat Chem Biol (2018) 14:853-860. DOI 10.1038/s41589-018-0085-5 · PubMed
Other PDB entries of the same protein (UniProt Q16878 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6CDH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.