Crystal structure of a Fc fragment LALA mutant (L234A, L235A) of human IgG1 (crystal form 1). Determined by X-ray diffraction at 2.4 Å resolution. Released 27 Feb 2019.
Explore 6CHF in 3D Show helices and sheets RCSB PDB PDBe
6CHF contains 21 α-helices and 40 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 239-243 | 5 | 1 |
| α-helix | 244-246 | 3 | |
| α-helix | 247-251 | 5 | |
| β-strand | 258-266 | 9 | 1 |
| β-strand | 274-279 | 6 | 2 |
| β-strand | 282-284 | 3 | 2 |
| β-strand | 288-289 | 2 | 1 |
| β-strand | 293-294 | 2 | 1 |
| β-strand | 300-307 | 8 | 1 |
| α-helix | 310-314 | 5 | |
| β-strand | 319-324 | 6 | 2 |
| β-strand | 332-336 | 5 | 2 |
| α-helix | 338-340 | 3 | |
| β-strand | 344 | 1 | 3 |
| α-helix | 345-346 | 2 | |
| β-strand | 347-351 | 5 | 4 |
| α-helix | 352-354 | 3 | |
| α-helix | 355-359 | 5 | |
| β-strand | 362-372 | 11 | 4 |
| β-strand | 373 | 1 | 3 |
| β-strand | 378-383 | 6 | 5 |
| β-strand | 386-387 | 2 | 5 |
| β-strand | 391-393 | 3 | 4 |
| α-helix | 394-396 | 3 | |
| β-strand | 397-398 | 2 | 4 |
| β-strand | 404-413 | 10 | 4 |
| α-helix | 414-418 | 5 | |
| β-strand | 423-428 | 6 | 5 |
| α-helix | 433-435 | 3 | |
| β-strand | 436-441 | 6 | 5 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 239-243 | 5 | 6 |
| α-helix | 244-246 | 3 | |
| α-helix | 247-251 | 5 | |
| β-strand | 258-264 | 7 | 6 |
| β-strand | 274-279 | 6 | 7 |
| β-strand | 282-284 | 3 | 7 |
| β-strand | 287-289 | 3 | 6 |
| α-helix | 290-292 | 3 | |
| β-strand | 293 | 1 | 6 |
| β-strand | 301-307 | 7 | 6 |
| α-helix | 310-314 | 5 | |
| β-strand | 319-324 | 6 | 7 |
| β-strand | 332-336 | 5 | 7 |
| α-helix | 338-340 | 3 | |
| β-strand | 344 | 1 | 8 |
| α-helix | 345-346 | 2 | |
| β-strand | 347-351 | 5 | 9 |
| α-helix | 352-354 | 3 | |
| α-helix | 355-359 | 5 | |
| β-strand | 362-372 | 11 | 9 |
| β-strand | 373 | 1 | 8 |
| β-strand | 378-383 | 6 | 10 |
| β-strand | 386-387 | 2 | 10 |
| β-strand | 391-393 | 3 | 9 |
| α-helix | 394-396 | 3 | |
| β-strand | 397-398 | 2 | 9 |
| β-strand | 404-413 | 10 | 9 |
| α-helix | 414-418 | 5 | |
| β-strand | 423-428 | 6 | 10 |
| α-helix | 433-435 | 3 | |
| β-strand | 436-441 | 6 | 10 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Uncharacterized protein DKFZp686C11235 | A, B | protein | 214 | Homo sapiens | Q6MZV7 (AlphaFold model) |
>6CHF_1 Uncharacterized protein DKFZp686C11235 (chains A, B) AAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPRE EQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPP SREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVD KSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Antigen-Induced Allosteric Changes in a Human IgG1 Fc Increase Low-Affinity Fc gamma Receptor Binding. Orlandi, C., Deredge, D., Ray, K. et al. Structure (2020). DOI 10.1016/j.str.2020.03.001 · PubMed
Other PDB entries of the same protein (UniProt Q6MZV7 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6CHF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.