6CMM: Human vaccinia-related kinase

Crystal Structure of the Human vaccinia-related kinase bound to a N,N-dipropynyl-dihydropteridine inhibitor. Determined by X-ray diffraction at 2.1 Å resolution. Released 21 Mar 2018.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Homo sapiens
Chains: 4
Atoms: 10,579
Mol. weight: 166.47 kDa
Ligands: F7D
Released: 21 Mar 2018

Explore 6CMM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6CMM contains 71 α-helices and 50 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 17 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	28-30	3	1
β-strand	36-42	7	1
β-strand	51-56	6	1
α-helix	61-62	2
β-strand	68-74	7	1
α-helix	78-90	13
α-helix	93-102	10
α-helix	111-112	2
β-strand	113-121	9	1
β-strand	124-132	9	1
β-strand	134-137	4	2
α-helix	138-144	7
α-helix	151-170	20
β-strand	174	1	3
α-helix	180-182	3
β-strand	183-186	4	2
β-strand	189-195	7	2
β-strand	202	1	3
α-helix	206-208	3
α-helix	210-212	3
α-helix	230-233	4
α-helix	240-256	17
α-helix	268-280	13
α-helix	282-289	8
α-helix	294-296	3
α-helix	297-307	11
α-helix	313-315	3
α-helix	317-330	14

Chain B: 19 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	28-30	3	4
β-strand	36-44	9	4
β-strand	51-56	6	4
β-strand	58	1	5
β-strand	60	1	5
α-helix	61-63	3
β-strand	68-74	7	4
α-helix	78-90	13
α-helix	93-102	10
α-helix	110-112	3
β-strand	113-118	6	4
β-strand	126-132	7	4
β-strand	137	1	6
α-helix	138-144	7
α-helix	151-170	20
β-strand	173-174	2	7
α-helix	180-182	3
β-strand	183-186	4	6
β-strand	189-195	7	6
β-strand	202-203	2	7
α-helix	206-208	3
α-helix	210-213	4
β-strand	215	1	8
α-helix	217-219	3
α-helix	230-233	4
β-strand	236	1	8
α-helix	237-238	2
α-helix	240-256	17
α-helix	268-280	13
α-helix	282-289	8
α-helix	294-296	3
α-helix	297-308	12
α-helix	313-315	3
α-helix	317-330	14

Chain C: 17 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	28-30	3	9
β-strand	36-42	7	9
β-strand	51-56	6	9
α-helix	61-62	2
β-strand	68-74	7	9
α-helix	78-90	13
α-helix	93-102	10
α-helix	111-112	2
β-strand	113-121	9	9
β-strand	124-132	9	9
β-strand	134-137	4	10
α-helix	138-144	7
α-helix	151-170	20
β-strand	174	1	11
α-helix	180-182	3
β-strand	183-186	4	10
β-strand	189-195	7	10
β-strand	202	1	11
α-helix	206-208	3
α-helix	210-212	3
α-helix	230-233	4
α-helix	240-256	17
α-helix	260-264	5
α-helix	268-280	13
α-helix	282-289	8
α-helix	297-307	11
α-helix	313-315	3
α-helix	317-330	14

Chain D: 18 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	28-31	4	12
β-strand	36-44	9	12
β-strand	51-56	6	12
α-helix	61-63	3
β-strand	68-74	7	12
α-helix	79-90	12
α-helix	93-102	10
α-helix	111-112	2
β-strand	113-121	9	12
β-strand	124-132	9	12
β-strand	137	1	13
α-helix	138-144	7
α-helix	151-170	20
β-strand	173-174	2	14
α-helix	180-182	3
β-strand	183-186	4	13
β-strand	189-195	7	13
β-strand	202-203	2	14
α-helix	206-208	3
β-strand	215	1	15
α-helix	217-219	3
α-helix	230-233	4
β-strand	236	1	15
α-helix	237-238	2
α-helix	240-256	17
α-helix	268-280	13
α-helix	282-289	8
α-helix	292-294	3
α-helix	297-308	12
α-helix	313-315	3
α-helix	317-330	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Serine/threonine-protein kinase VRK1	A, B, C, D	protein	364	Homo sapiens	Q99986 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>6CMM_1 Serine/threonine-protein kinase VRK1 (chains A, B, C, D)
SMRVKAAQAGRQSSAKRHLAEQFAVGEIITDMAAAAWKVGLPIGQGGFGCIYLADMNSSE
SVGSDAPCVVKVEPSDNGPLFTELKFYQRAAKPEQIQKWIRTRKLKYLGVPKYWGSGLHD
KNGKSYRFMIMDRFGSDLQKIYEANAKRFSRKTVLQLSLRILDILEYIHEHEYVHGDIKA
SNLLLNYKNPDQVYLVDYGLAYRYCPEGVHKAYAADPKRCHDGTIEFTSIDAHNGVAPSR
RGDLEILGYCMIQWLTGHLPWEDNLKDPKYVRDSKIRYRENIASLMDKCFPAANAPGEIA
KYMETVKLLDYTEKPLYENLRDILLQGLKAIGSKDDGKLDLSVVENGGLKAKTITKKRAA
EIEE

Ligands and cofactors

ID	Name	Formula	Copies
F7D	(7R)-2-[(3,5-difluoro-4-hydroxyphenyl)amino]-7-methyl-5,8-di(prop-2-yn-1-yl)-7,…	C19 H15 F2 N5 O2	2

Water and common crystallization additives (ACT, SO4, PEG) are not listed.

Primary citation

Crystal Structure of the Human vaccinia-related kinase bound to a N,N-dipropynyl-dihydropteridine inhibitor. dos Reis, C.V., de Souza, G.P., Counago, R.M. et al. To be published.

Other PDB entries of the same protein (UniProt Q99986 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7M10 1.15 Å, PHF2 PHD Domain Complexed with Peptide From N-terminus of VRK1
6BRU 1.8 Å, Crystal Structure of the Human vaccinia-related kinase bound to a…
6BU6 1.8 Å, Crystal Structure of the Human vaccinia-related kinase bound to a…
6BP0 1.9 Å, Crystal Structure of the Human vaccinia-related kinase 1 bound to…
6BTW 1.9 Å, Crystal Structure of the Human vaccinia-related kinase bound to a phenyl-pteridinone…
5UVF 2.0 Å, Crystal Structure of the Human vaccinia-related kinase bound to BI-D1870
6CNX 2.0 Å, Crystal Structure of the Human vaccinia-related kinase 1 (VRK1) bound to an…
6VXU 2.0 Å, Structure of Human Vaccinia-related Kinase 1 (VRK1) bound to ACH471
9ZKG 2.06 Å, VRK1 in complex with the inhibitor MP-60
6AC9 2.07 Å, Crystal structure of human Vaccinia-related kinase 1 (VRK1) in complex with AMP-PNP
6DD4 2.1 Å, Crystal Structure of the Human vaccinia-related kinase bound to a…
6CQH 2.15 Å, Crystal Structure of the Human vaccinia-related kinase bound to a…

Browse structure collections

About this viewer

MolViewer shows 6CMM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.