6CPH: F24 TCR

Crystal structure of the F24 TCR. Determined by X-ray diffraction at 1.7 Å resolution. Released 6 Jun 2018.

Method: X-ray diffraction
Resolution: 1.7 Å
Organism: Homo sapiens
Chains: 2
Atoms: 4,080
Mol. weight: 51.2 kDa
Released: 6 Jun 2018

Explore 6CPH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6CPH contains 11 α-helices and 43 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain D: 5 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	5-7	3	1
β-strand	10-14	5	2
β-strand	19-24	6	1
β-strand	33-44	7	2
α-helix	49-50	2
β-strand	51-56	6	2
β-strand	66-69	4	1
β-strand	72-75	4	1
β-strand	77	1	1
β-strand	82-87	6	1
α-helix	92-94	3
β-strand	96-103	8	2
β-strand	110-112	3	2
β-strand	116-121	6	2
β-strand	130-135	6	3
β-strand	136	1	4
β-strand	143-148	6	3
α-helix	157-159	3
β-strand	164-166	3	3
α-helix	167-169	3
β-strand	170-174	5	3
β-strand	179-188	10	3
α-helix	195-198	4
β-strand	209	1	3

Chain E: 6 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	5-7	3	5
β-strand	10-14	5	6
β-strand	19-24	6	5
β-strand	31-44	7	6
β-strand	50-57	8	6
β-strand	60-68	5	6
β-strand	76-79	4	5
β-strand	87-91	5	5
α-helix	96-98	3
β-strand	100-107	8	6
β-strand	120-121	2	6
β-strand	125-130	6	6
β-strand	137	1	7
α-helix	138-139	2
β-strand	140-144	5	4
α-helix	145-147	3
α-helix	148-154	7
β-strand	156-166	11	4
β-strand	167	1	7
β-strand	172-177	6	8
β-strand	180-182	3	8
β-strand	186-188	3	4
β-strand	193-194	2	4
β-strand	204-213	10	4
α-helix	214-217	4
β-strand	223-230	8	8
β-strand	233	1	9
α-helix	244-245	2
β-strand	247	1	9
β-strand	249-256	8	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
TCR alpha chain	D	protein	205	Homo sapiens	A0A0B4J272 (AlphaFold model)
TCR beta chain	E	protein	245	Homo sapiens	A0A5B9 (AlphaFold model)

Sequence of entity 1 (D), FASTA

>6CPH_1 TCR alpha chain (chains D)
ILNVEQSPQSLHVQEGDSTNFTCSFPSSNFYALHWYRWETAKSPEALFVMTLNGDEKKKG
RISATLNTKEGYSYLYIKGSQPEDSATYLCAFKAAGNKLTFGGGTRVLVKPNIQNPDPAV
YQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKS
DFACANAFNNSIIPEDTFFPSPESS

Sequence of entity 2 (E), FASTA

>6CPH_2 TCR beta chain (chains E)
EPEVTQTPSHQVTQMGQEVILRCVPISNHLYFYWYRQILGQKVEFLVSFYNNEISEKSEI
FDDQFSVERPDGSNFTLKIRSTKLEDSAMYFCASSRLAGGMDEQFFGPGTRLTVLEDLKN
VFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKE
QPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEA
WGRAD

Primary citation

CD4+T cell-mediated HLA class II cross-restriction in HIV controllers. Galperin, M., Farenc, C., Mukhopadhyay, M. et al. Sci Immunol (2018) 3. DOI 10.1126/sciimmunol.aat0687 · PubMed

Other PDB entries of the same protein (UniProt A0A0B4J272 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6CQL 2.4 Å, Crystal structure of F24 TCR -DR11-RQ13 peptide complex
6CQN 2.5 Å, Crystal structure of F5 TCR -DR11-RQ13 peptide complex
6CQQ 2.8 Å, Crystal structure of F24 TCR -DR15-RQ13 peptide complex
6CQR 3.04 Å, Crystal structure of F24 TCR -DR1-RQ13 peptide complex

Browse structure collections

About this viewer

MolViewer shows 6CPH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.