Solution structure of SH3 domain from Shank3. Determined by solution NMR. Released 15 Aug 2018.
Explore 6CPK in 3D Show helices and sheets RCSB PDB PDBe
6CPK contains 1 α-helix and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 476-478 | 3 | 1 |
| β-strand | 482 | 1 | 2 |
| β-strand | 489 | 1 | 1 |
| β-strand | 492 | 1 | 2 |
| β-strand | 497-503 | 7 | 1 |
| β-strand | 508-513 | 6 | 1 |
| β-strand | 516-521 | 6 | 1 |
| α-helix | 522-524 | 3 | |
| β-strand | 525-527 | 3 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| SH3 and multiple ankyrin repeat domains protein 3 | A | protein | 61 | Homo sapiens | Q9BYB0 (AlphaFold model) |
>6CPK_1 SH3 and multiple ankyrin repeat domains protein 3 (chains A) MVPGRKFIAVKAHSPQGEGEIPLHRGEAVKVLSIGEGGFWEGTVKGRTGWFPADCVEEVQ M
Solution structures of the SH3 domains from Shank scaffold proteins and their interactions with Cav1.3 calcium channels. Ishida, H., Skorobogatov, A., Yamniuk, A.P. et al. FEBS Lett (2018) 592:2786-2797. DOI 10.1002/1873-3468.13209 · PubMed
Other PDB entries of the same protein (UniProt Q9BYB0 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6CPK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.