6CW7: Dihydrofolate reductase

E. coli DHFR product complex with (6S)-5,6,7,8-TETRAHYDROFOLATE. Determined by X-ray diffraction at 1.03 Å resolution. Released 9 Jan 2019.

Method: X-ray diffraction
Resolution: 1.03 Å
Organism: Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Chains: 1
Atoms: 1,672
Mol. weight: 19.5 kDa
Ligands: MG, THG
Released: 9 Jan 2019

Explore 6CW7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6CW7 contains 10 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	2-8	7	1
α-helix	10-12	3
β-strand	13	1	2
α-helix	17-19	3
α-helix	25-35	11
β-strand	40-43	4	1
α-helix	44-50	7
α-helix	53-54	2
β-strand	59-62	4	1
β-strand	73-75	3	1
α-helix	78-85	8
β-strand	91-93	3	1
α-helix	97-103	7
α-helix	104-106	3
β-strand	109-115	7	1
β-strand	124	1	2
α-helix	125-127	3
α-helix	130-132	3
β-strand	133-141	9	1
β-strand	151-158	8	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Dihydrofolate reductase	A	protein	165	Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)	P0ABQ4 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6CW7_1 Dihydrofolate reductase (chains A)
MISLIAALAVDRVIGMENAMPWNLPADLAWFKRNTLNKPVIMGRHTWESIGRPLPGRKNI
ILSSQPGTDDRVTWVKSVDEAIAACGDVPEIMVIGGGRVYEQFLPKAQKLYLTHIDAEVE
GDTHFPDYEPDDWESVFSEFHDADAQNSHSYCFEILERRHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	4
THG	(6S)-5,6,7,8-tetrahydrofolate	C19 H23 N7 O6	1

Water and common crystallization additives (CL) are not listed.

Primary citation

The crystal structure of a tetrahydrofolate-bound dihydrofolate reductase reveals the origin of slow product release. Cao, H., Gao, M., Zhou, H. et al. Commun Biol (2018) 1:226-226. DOI 10.1038/s42003-018-0236-y · PubMed

Other PDB entries of the same protein (UniProt P0ABQ4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

45PC 0.85 Å, 6-conformation model of Escherichia coli dihydrofolate reductase at 100K
9PWM 0.89 Å, Dihydrofolate Reductase Complexed with Folate and Nicotinamide Adenine Dinucleotide…
8UW0 0.93 Å, Escherichia coli DHFR bound to NADP+ and folate, 17.2 MGy dose
7FPP 1.03 Å, DHFR:NADP+:FOL complex at 280 K (crystal 5)
7FPQ 1.03 Å, DHFR:NADP+:FOL complex at 280 K (multi-crystal)
7FPM 1.04 Å, DHFR:NADP+:FOL complex at 280 K (crystal 2)
7FPN 1.04 Å, DHFR:NADP+:FOL complex at 280 K (crystal 3)
7FPV 1.04 Å, DHFR:NADP+:FOL complex at 290 K (crystal 5)
7FPW 1.04 Å, DHFR:NADP+:FOL complex at 290 K (multi-crystal)
7FPU 1.05 Å, DHFR:NADP+:FOL complex at 290 K (crystal 4)
5SSW 1.06 Å, DHFR:NADP+:FOL complex at 270 K (multi-crystal)
7FPO 1.06 Å, DHFR:NADP+:FOL complex at 280 K (crystal 4)

Browse structure collections

About this viewer

MolViewer shows 6CW7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.