Crystal structure of the human TIM-3 with bound Calcium. Determined by X-ray diffraction at 1.7 Å resolution. Released 12 Dec 2018.
Explore 6DHB in 3D Show helices and sheets RCSB PDB PDBe
6DHB contains 3 α-helices and 14 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-6 | 5 | 1 |
| β-strand | 12-14 | 3 | 2 |
| β-strand | 17 | 1 | 3 |
| β-strand | 22 | 1 | 4 |
| β-strand | 25 | 1 | 4 |
| β-strand | 29-33 | 5 | 1 |
| β-strand | 44-48 | 5 | 1 |
| β-strand | 53-55 | 3 | 1 |
| β-strand | 57 | 1 | 2 |
| β-strand | 60-62 | 3 | 2 |
| α-helix | 66-68 | 3 | |
| β-strand | 70 | 1 | 3 |
| α-helix | 72 | 1 | |
| β-strand | 73-75 | 3 | 2 |
| α-helix | 80-82 | 3 | |
| β-strand | 84-90 | 7 | 1 |
| β-strand | 99-107 | 9 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Hepatitis A virus cellular receptor 2 | A | protein | 108 | Homo sapiens | Q8TDQ0 (AlphaFold model) |
>6DHB_1 Hepatitis A virus cellular receptor 2 (chains A) MVEYRAEVGQNAYLPCFYTPAAPGNLVPVCWGKGACPVFECGNVVLRTDERDVNYWTSRY WLNGDFRKGDVSLTIENVTLADSGIYCCRIQIPGIMNDEKFNLKLVIK
Water and common crystallization additives (EDO) are not listed.
High resolution X-ray and NMR structural study of human T-cell immunoglobulin and mucin domain containing protein-3. Gandhi, A.K., Kim, W.M., Sun, Z.J. et al. Sci Rep (2018) 8:17512-17512. DOI 10.1038/s41598-018-35754-0 · PubMed
Other PDB entries of the same protein (UniProt Q8TDQ0 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6DHB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.