6DHE: Photosystem II protein D1 1
RT XFEL structure of the dark-stable state of Photosystem II (0F, S1-rich) at 2.05 Angstrom resolution. Determined by X-ray diffraction at 2.05 Å resolution. Released 21 Nov 2018.
- Method
- X-ray diffraction
- Resolution
- 2.05 Å
- Organisms
- Thermosynechococcus elongatus (strain BP-1), Thermosynechococcus elongatus
- Chains
- 40
- Atoms
- 52,206
- Mol. weight
- 730.7 kDa
- Ligands
- DGD, HEC, HEM, BCT
- Released
- 21 Nov 2018
Explore 6DHE in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
6DHE contains 296 α-helices and 178 β-strands across 40 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain a: 22 helices, 11 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 13-21 | 9 | |
| α-helix | 32-54 | 23 | |
| α-helix | 55-57 | 3 | |
| β-strand | 58 | 1 | 45 |
| α-helix | 66 | 1 | |
| β-strand | 67 | 1 | 45 |
| α-helix | 68 | 1 | |
| α-helix | 71-73 | 3 | |
| β-strand | 81-82 | 2 | 46 |
| α-helix | 83-86 | 4 | |
| α-helix | 96-98 | 3 | |
| α-helix | 102-108 | 7 | |
| α-helix | 110-137 | 28 | |
| α-helix | 143-155 | 13 | |
| α-helix | 156-160 | 5 | |
| α-helix | 161-165 | 5 | |
| α-helix | 168-170 | 3 | |
| α-helix | 172-173 | 2 | |
| β-strand | 174-175 | 2 | 46 |
| α-helix | 176-190 | 15 | |
| α-helix | 192-194 | 3 | |
| α-helix | 196-221 | 26 | |
| β-strand | 223 | 1 | 47 |
| β-strand | 224 | 1 | 48 |
| α-helix | 233-236 | 4 | |
| β-strand | 243 | 1 | 49 |
| β-strand | 246 | 1 | 47 |
| α-helix | 248-258 | 11 | |
| α-helix | 268-293 | 26 | |
| β-strand | 297-298 | 2 | 50 |
| β-strand | 307 | 1 | 51 |
| β-strand | 313 | 1 | 51 |
| α-helix | 317-331 | 15 | |
Chain A: 24 helices, 11 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 13-21 | 9 | |
| α-helix | 31-54 | 24 | |
| α-helix | 55-57 | 3 | |
| β-strand | 58 | 1 | 1 |
| α-helix | 66 | 1 | |
| β-strand | 67 | 1 | 1 |
| α-helix | 68 | 1 | |
| α-helix | 71-73 | 3 | |
| β-strand | 81-82 | 2 | 2 |
| α-helix | 83-86 | 4 | |
| α-helix | 96-98 | 3 | |
| α-helix | 102-108 | 7 | |
| α-helix | 110-136 | 27 | |
| α-helix | 143-155 | 13 | |
| α-helix | 156-160 | 5 | |
| α-helix | 161-165 | 5 | |
| α-helix | 168-170 | 3 | |
| α-helix | 172-173 | 2 | |
| β-strand | 174-175 | 2 | 2 |
| α-helix | 176-190 | 15 | |
| α-helix | 192-194 | 3 | |
| α-helix | 196-221 | 26 | |
| β-strand | 223 | 1 | 3 |
| β-strand | 224 | 1 | 4 |
| α-helix | 225 | 1 | |
| α-helix | 233-236 | 4 | |
| β-strand | 243 | 1 | 5 |
| β-strand | 246 | 1 | 3 |
| α-helix | 248-258 | 11 | |
| α-helix | 261-263 | 3 | |
| α-helix | 268-293 | 26 | |
| β-strand | 297-298 | 2 | 6 |
| β-strand | 307 | 1 | 7 |
| β-strand | 313 | 1 | 7 |
| α-helix | 317-331 | 15 | |
Chain b: 28 helices, 27 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 3-4 | 2 | 52 |
| α-helix | 5-12 | 8 | |
| α-helix | 16-44 | 29 | |
| α-helix | 55-57 | 3 | |
| α-helix | 63-68 | 6 | |
| β-strand | 73 | 1 | 53 |
| β-strand | 78 | 1 | 54 |
| β-strand | 79 | 1 | 53 |
| β-strand | 84 | 1 | 54 |
| α-helix | 93-116 | 24 | |
| β-strand | 120 | 1 | 55 |
| α-helix | 121-123 | 3 | |
| β-strand | 124 | 1 | 56 |
| β-strand | 131 | 1 | 56 |
| α-helix | 135-152 | 18 | |
| α-helix | 153-158 | 6 | |
| β-strand | 166-168 | 3 | 57 |
| β-strand | 177-179 | 3 | 57 |
| α-helix | 187-190 | 4 | |
| α-helix | 195-218 | 24 | |
| α-helix | 220-221 | 2 | |
| β-strand | 222 | 1 | 58 |
| α-helix | 223-228 | 6 | |
| α-helix | 234-258 | 25 | |
| α-helix | 265-268 | 4 | |
| α-helix | 272-276 | 5 | |
| α-helix | 279-293 | 15 | |
| α-helix | 298-303 | 6 | |
| α-helix | 307-312 | 6 | |
| β-strand | 314 | 1 | 59 |
| α-helix | 315-317 | 3 | |
| α-helix | 319-321 | 3 | |
| β-strand | 323 | 1 | 60 |
| α-helix | 330-332 | 3 | |
| β-strand | 336-342 | 7 | 61 |
| β-strand | 343-347 | 5 | 62 |
| β-strand | 353-354 | 2 | 62 |
| β-strand | 355-356 | 2 | 63 |
| α-helix | 357-360 | 4 | |
| β-strand | 369-371 | 3 | 63 |
| β-strand | 377-380 | 4 | 63 |
| α-helix | 392-395 | 4 | |
| β-strand | 398-402 | 5 | 62 |
| β-strand | 410-411 | 2 | 62 |
| α-helix | 414-424 | 11 | |
| β-strand | 427 | 1 | 59 |
| β-strand | 429-433 | 5 | 61 |
| α-helix | 447-474 | 28 | |
| α-helix | 476-478 | 3 | |
| β-strand | 482 | 1 | 48 |
| α-helix | 488-491 | 4 | |
| β-strand | 496 | 1 | 64 |
| β-strand | 498 | 1 | 65 |
| α-helix | 502-504 | 3 | |
| β-strand | 505 | 1 | 64 |
Chain B: 26 helices, 27 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 3-4 | 2 | 8 |
| α-helix | 5-12 | 8 | |
| α-helix | 16-44 | 29 | |
| α-helix | 55-57 | 3 | |
| α-helix | 63-68 | 6 | |
| β-strand | 73 | 1 | 9 |
| β-strand | 78 | 1 | 10 |
| β-strand | 79 | 1 | 9 |
| β-strand | 84 | 1 | 10 |
| α-helix | 93-116 | 24 | |
| β-strand | 120 | 1 | 11 |
| α-helix | 121-123 | 3 | |
| β-strand | 124 | 1 | 12 |
| β-strand | 131 | 1 | 12 |
| α-helix | 135-152 | 18 | |
| α-helix | 153-158 | 6 | |
| β-strand | 166-168 | 3 | 13 |
| β-strand | 177-179 | 3 | 13 |
| α-helix | 187-190 | 4 | |
| α-helix | 195-218 | 24 | |
| α-helix | 220-221 | 2 | |
| β-strand | 222 | 1 | 14 |
| α-helix | 223-228 | 6 | |
| α-helix | 234-258 | 25 | |
| α-helix | 265-268 | 4 | |
| α-helix | 272-276 | 5 | |
| α-helix | 279-293 | 15 | |
| α-helix | 298-303 | 6 | |
| α-helix | 307-312 | 6 | |
| β-strand | 314 | 1 | 15 |
| α-helix | 315-317 | 3 | |
| β-strand | 323 | 1 | 16 |
| α-helix | 330-332 | 3 | |
| β-strand | 336-342 | 7 | 17 |
| β-strand | 343-347 | 5 | 18 |
| β-strand | 353-354 | 2 | 18 |
| β-strand | 355-356 | 2 | 19 |
| α-helix | 357-360 | 4 | |
| β-strand | 369-371 | 3 | 19 |
| β-strand | 377-380 | 4 | 19 |
| α-helix | 392-395 | 4 | |
| β-strand | 398-402 | 5 | 18 |
| β-strand | 410-411 | 2 | 18 |
| α-helix | 414-424 | 11 | |
| β-strand | 427 | 1 | 15 |
| β-strand | 429-433 | 5 | 17 |
| α-helix | 447-474 | 28 | |
| α-helix | 476-478 | 3 | |
| β-strand | 482 | 1 | 4 |
| α-helix | 488-491 | 4 | |
| β-strand | 496 | 1 | 20 |
| β-strand | 498 | 1 | 21 |
| β-strand | 505 | 1 | 20 |
Chain c: 25 helices, 15 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 28-31 | 4 | |
| α-helix | 35-42 | 8 | |
| α-helix | 46-74 | 29 | |
| α-helix | 81-83 | 3 | |
| α-helix | 89-94 | 6 | |
| β-strand | 99 | 1 | 66 |
| α-helix | 101-103 | 3 | |
| β-strand | 105 | 1 | 66 |
| α-helix | 109-130 | 22 | |
| α-helix | 131-135 | 5 | |
| α-helix | 154-180 | 27 | |
| β-strand | 185-187 | 3 | 67 |
| β-strand | 195-197 | 3 | 67 |
| α-helix | 206-209 | 4 | |
| α-helix | 211-214 | 4 | |
| α-helix | 223-226 | 4 | |
| α-helix | 230-253 | 24 | |
| α-helix | 258-263 | 6 | |
| α-helix | 268-292 | 25 | |
| α-helix | 299-302 | 4 | |
| α-helix | 306-324 | 19 | |
| β-strand | 332 | 1 | 68 |
| β-strand | 338 | 1 | 68 |
| β-strand | 341-343 | 3 | 69 |
| β-strand | 349-351 | 3 | 69 |
| α-helix | 354-358 | 5 | |
| α-helix | 367-369 | 3 | |
| β-strand | 370-371 | 2 | 69 |
| β-strand | 374-375 | 2 | 69 |
| α-helix | 377-382 | 6 | |
| α-helix | 386-396 | 11 | |
| β-strand | 402-403 | 2 | 50 |
| β-strand | 407 | 1 | 70 |
| β-strand | 408 | 1 | 50 |
| α-helix | 413-414 | 2 | |
| β-strand | 418 | 1 | 70 |
| α-helix | 422-453 | 32 | |
| β-strand | 459 | 1 | 71 |
| α-helix | 461-463 | 3 | |
| α-helix | 465-468 | 4 | |
Chain C: 24 helices, 15 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 35-42 | 8 | |
| α-helix | 46-74 | 29 | |
| α-helix | 81-83 | 3 | |
| α-helix | 89-94 | 6 | |
| β-strand | 99 | 1 | 22 |
| α-helix | 101-103 | 3 | |
| β-strand | 105 | 1 | 22 |
| α-helix | 109-130 | 22 | |
| α-helix | 131-135 | 5 | |
| α-helix | 154-180 | 27 | |
| β-strand | 185-187 | 3 | 23 |
| β-strand | 195-197 | 3 | 23 |
| α-helix | 206-214 | 9 | |
| α-helix | 223-226 | 4 | |
| α-helix | 230-253 | 24 | |
| α-helix | 258-261 | 4 | |
| α-helix | 268-292 | 25 | |
| α-helix | 299-302 | 4 | |
| α-helix | 306-323 | 18 | |
| β-strand | 332 | 1 | 24 |
| β-strand | 338 | 1 | 24 |
| β-strand | 341-343 | 3 | 25 |
| β-strand | 349-351 | 3 | 25 |
| α-helix | 353-358 | 6 | |
| α-helix | 367-369 | 3 | |
| β-strand | 370-371 | 2 | 25 |
| β-strand | 374-375 | 2 | 25 |
| α-helix | 377-383 | 7 | |
| α-helix | 386-396 | 11 | |
| β-strand | 402-403 | 2 | 6 |
| β-strand | 407 | 1 | 26 |
| β-strand | 408 | 1 | 6 |
| α-helix | 413-414 | 2 | |
| β-strand | 418 | 1 | 26 |
| α-helix | 422-453 | 32 | |
| β-strand | 459 | 1 | 27 |
| α-helix | 461-463 | 3 | |
| α-helix | 465-468 | 4 | |
| α-helix | 470-471 | 2 | |
Chain d: 22 helices, 10 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 14-22 | 9 | |
| β-strand | 24 | 1 | 65 |
| α-helix | 31-54 | 24 | |
| β-strand | 57 | 1 | 72 |
| α-helix | 58-61 | 4 | |
| β-strand | 63 | 1 | 72 |
| β-strand | 77-78 | 2 | 73 |
| α-helix | 79-82 | 4 | |
| α-helix | 83-85 | 3 | |
| α-helix | 101-107 | 7 | |
| α-helix | 109-136 | 28 | |
| α-helix | 141-145 | 5 | |
| α-helix | 147-154 | 8 | |
| α-helix | 155-159 | 5 | |
| α-helix | 160-163 | 4 | |
| α-helix | 167-169 | 3 | |
| β-strand | 173-174 | 2 | 73 |
| α-helix | 175-189 | 15 | |
| α-helix | 191-193 | 3 | |
| α-helix | 195-219 | 25 | |
| β-strand | 222 | 1 | 74 |
| β-strand | 223 | 1 | 71 |
| α-helix | 231-233 | 3 | |
| β-strand | 241 | 1 | 49 |
| β-strand | 244 | 1 | 74 |
| α-helix | 246-257 | 12 | |
| α-helix | 264-290 | 27 | |
| β-strand | 294 | 1 | 60 |
| α-helix | 299-307 | 9 | |
| α-helix | 314-333 | 20 | |
| α-helix | 335-337 | 3 | |
| α-helix | 343-345 | 3 | |
Chain D: 22 helices, 10 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 14-22 | 9 | |
| β-strand | 24 | 1 | 21 |
| α-helix | 33-54 | 22 | |
| β-strand | 57 | 1 | 28 |
| β-strand | 63 | 1 | 28 |
| α-helix | 67-69 | 3 | |
| β-strand | 77-78 | 2 | 29 |
| α-helix | 79-82 | 4 | |
| α-helix | 83-85 | 3 | |
| α-helix | 101-107 | 7 | |
| α-helix | 109-136 | 28 | |
| α-helix | 141-153 | 13 | |
| α-helix | 154-159 | 6 | |
| α-helix | 160-163 | 4 | |
| α-helix | 167-169 | 3 | |
| α-helix | 171-172 | 2 | |
| β-strand | 173-174 | 2 | 29 |
| α-helix | 175-189 | 15 | |
| α-helix | 191-193 | 3 | |
| α-helix | 195-219 | 25 | |
| β-strand | 222 | 1 | 30 |
| β-strand | 223 | 1 | 27 |
| α-helix | 231-234 | 4 | |
| β-strand | 241 | 1 | 5 |
| β-strand | 244 | 1 | 30 |
| α-helix | 246-257 | 12 | |
| α-helix | 264-290 | 27 | |
| β-strand | 294 | 1 | 16 |
| α-helix | 299-307 | 9 | |
| α-helix | 314-333 | 20 | |
| α-helix | 335-337 | 3 | |
| α-helix | 343-345 | 3 | |
28 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Photosystem II protein D1 1 | A, a | protein | 334 | Thermosynechococcus elongatus (strain BP-1) | P0A444 (AlphaFold model) |
| Photosystem II CP47 reaction center protein | B, b | protein | 505 | Thermosynechococcus elongatus (strain BP-1) | Q8DIQ1 (AlphaFold model) |
| Photosystem II CP43 reaction center protein | C, c | protein | 451 | Thermosynechococcus elongatus (strain BP-1) | Q8DIF8 (AlphaFold model) |
| Photosystem II D2 protein | D, d | protein | 341 | Thermosynechococcus elongatus (strain BP-1) | Q8CM25 (AlphaFold model) |
| Cytochrome b559 subunit alpha | E, e | protein | 82 | Thermosynechococcus elongatus (strain BP-1) | Q8DIP0 |
| Cytochrome b559 subunit beta | F, f | protein | 34 | Thermosynechococcus elongatus (strain BP-1) | Q8DIN9 |
| Photosystem II reaction center protein H | H, h | protein | 65 | Thermosynechococcus elongatus (strain BP-1) | Q8DJ43 |
| Photosystem II reaction center protein I | I, i | protein | 36 | Thermosynechococcus elongatus | Q8DJZ6 |
| Photosystem II reaction center protein J | J, j | protein | 36 | Thermosynechococcus elongatus (strain BP-1) | P59087 |
| Photosystem II reaction center protein K | K, k | protein | 37 | Thermosynechococcus elongatus (strain BP-1) | Q9F1K9 |
| Photosystem II reaction center protein L | L, l | protein | 37 | Thermosynechococcus elongatus (strain BP-1) | Q8DIN8 |
| Photosystem II reaction center protein M | M, m | protein | 33 | Thermosynechococcus elongatus | Q8DHA7 |
8 more molecules are not listed.
Sequence of entity 1 (A, a), FASTA
>6DHE_1 Photosystem II protein D1 1 (chains A, a)
ANLWERFCNWVTSTDNRLYVGWFGVIMIPTLLAATICFVIAFIAAPPVDIDGIREPVSGS
LLYGNNIITGAVVPSSNAIGLHFYPIWEAASLDEWLYNGGPYQLIIFHFLLGASCYMGRQ
WELSYRLGMRPWICVAYSAPLASAFAVFLIYPIGQGSFSDGMPLGISGTFNFMIVFQAEH
NILMHPFHQLGVAGVFGGALFCAMHGSLVTSSLIRETTETESANYGYKFGQEEETYNIVA
AHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGVWFTALGISTMAFNLNGFNFNHSVIDAK
GNVINTWADIINRANLGMEVMHERNAHNFPLDLA
Sequence of entity 2 (B, b), FASTA
>6DHE_2 Photosystem II CP47 reaction center protein (chains B, b)
GLPWYRVHTVLINDPGRLIAAHLMHTALVAGWAGSMALYELATFDPSDPVLNPMWRQGMF
VLPFMARLGVTGSWSGWSITGETGIDPGFWSFEGVALAHIVLSGLLFLAACWHWVYWDLE
LFRDPRTGEPALDLPKMFGIHLFLAGLLCFGFGAFHLTGLFGPGMWVSDPYGLTGSVQPV
APEWGPDGFNPYNPGGVVAHHIAAGIVGIIAGLFHILVRPPQRLYKALRMGNIETVLSSS
IAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDSSYFQQEINRRVQASLASGATLEEA
WSAIPEKLAFYDYIGNNPAKGGLFRTGPMNKGDGIAQAWKGHAVFRNKEGEELFVRRMPA
FFESFPVILTDKNGVVKADIPFRRAESKYSFEQQGVTVSFYGGELNGQTFTDPPTVKSYA
RKAIFGEIFEFDTETLNSDGIFRTSPRGWFTFAHAVFALLFFFGHIWHGARTLFRDVFSG
IDPELSPEQVEWGFYQKVGDVTTRR
Sequence of entity 3 (C, c), FASTA
>6DHE_3 Photosystem II CP43 reaction center protein (chains C, c)
ATNRDQESSGFAWWAGNARLINLSGKLLGAHVAHAGLIVFWAGAMTLFELAHFIPEKPMY
EQGLILIPHIATLGWGVGPGGEVVDTFPFFVVGVVHLISSAVLGFGGVYHAIRGPETLEE
YSSFFGYDWKDKNKMTTILGFHLIVLGIGALLLVAKAMFFGGLYDTWAPGGGDVRVITNP
TLDPRVIFGYLLKSPFGGEGWIVSVNNLEDVVGGHIWIGLICIAGGIWHILTTPFGWARR
AFIWSGEAYLSYSLGALSMMGFIATCFVWFNNTVYPSEFYGPTGPEASQAQAMTFLIRDQ
KLGANVGSAQGPTGLGKYLMRSPTGEIIFGGETMRFWDFRGPWLEPLRGPNGLDLNKIKN
DIQPWQERRAAEYMTHAPLGSLNSVGGVATEINSVNFVSPRSWLATSHFVLAFFFLVGHL
WHAGRARAAAAGFEKGIDRESEPVLSMPSLD
Sequence of entity 4 (D, d), FASTA
>6DHE_4 Photosystem II D2 protein (chains D, d)
RGWFDILDDWLKRDRFVFVGWSGILLFPCAYLALGGWLTGTTFVTSWYTHGLASSYLEGC
NFLTVAVSTPANSMGHSLLLLWGPEAQGDFTRWCQLGGLWTFIALHGAFGLIGFMLRQFE
IARLVGVRPYNAIAFSAPIAVFVSVFLIYPLGQSSWFFAPSFGVAAIFRFLLFFQGFHNW
TLNPFHMMGVAGVLGGALLCAIHGATVENTLFQDGEGASTFRAFNPTQAEETYSMVTANR
FWSQIFGIAFSNKRWLHFFMLFVPVTGLWMSAIGVVGLALNLRSYDFISQEIRAAEDPEF
ETFYTKNLLLNEGIRAWMAPQDQPHENFVFPEEVLPRGNAL
Sequence of entity 5 (E, e), FASTA
>6DHE_5 Cytochrome b559 subunit alpha (chains E, e)
GTTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRS
IPLVTDRFEAKQQVETFLEQLK
Sequence of entity 6 (F, f), FASTA
>6DHE_6 Cytochrome b559 subunit beta (chains F, f)
SYPIFTVRWVAVHTLAVPTIFFLGAIAAMQFIQR
Sequence of entity 7 (H, h), FASTA
>6DHE_7 Photosystem II reaction center protein H (chains H, h)
ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVS
WKALG
Sequence of entity 8 (I, i), FASTA
>6DHE_8 Photosystem II reaction center protein I (chains I, i)
METLKITVYIVVTFFVLLFVFGFLSGDPARNPKRKD
Sequence of entity 9 (J, j), FASTA
>6DHE_9 Photosystem II reaction center protein J (chains J, j)
GGRIPLWIVATVAGMGVIVIVGLFFYGAYAGLGSSL
Sequence of entity 10 (K, k), FASTA
>6DHE_10 Photosystem II reaction center protein K (chains K, k)
KLPEAYAIFDPLVDVLPVIPVLFLALAFVWQAAVGFR
Sequence of entity 11 (L, l), FASTA
>6DHE_11 Photosystem II reaction center protein L (chains L, l)
MEPNPNRQPVELNRTSLYLGLLLILVLALLFSSYFFN
Sequence of entity 12 (M, m), FASTA
>6DHE_12 Photosystem II reaction center protein M (chains M, m)
MEVNQLGLIATALFVLVPSVFLIILYVQTESQQ
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| DGD | Digalactosyl diacyl glycerol (DGDG) | C51 H96 O15 | 10 |
| HEC | Heme C | C34 H36 Fe N4 O4 | 2 |
| HEM | Protoporphyrin IX containing FE | C34 H32 Fe N4 O4 | 2 |
| BCT | Bicarbonate ion | C H O3 | 2 |
| LHG | 1,2-dipalmitoyl-phosphatidyl-glycerole | C38 H75 O10 P | 10 |
| BCR | Beta-carotene | C40 H56 | 10 |
| OEX | Ca-MN4-O5 cluster | Ca Mn4 O5 | 2 |
| SQD | 1,2-di-O-acyl-3-O-[6-deoxy-6-sulfo-alpha-D-glucopyranosyl]-sn-glycerol | C41 H78 O12 S | 8 |
| LMG | 1,2-distearoyl-monogalactosyl-diglyceride | C45 H86 O10 | 13 |
| PL9 | 2,3-dimethyl-5-(3,7,11,15,19,23,27,31,35-nonamethyl-2,6,10,14,18,22,26,30,34-he… | C53 H80 O2 | 4 |
| 8CT | (6'R,11cis,11'cis,13cis,15cis)-4',5'-didehydro-5',6'-dihydro-beta,beta-carotene | C40 H56 | 12 |
| PHO | Pheophytin a | C55 H74 N4 O5 | 4 |
| CLA | Chlorophyll a | C55 H72 Mg N4 O5 | 70 |
| FE2 | FE (II) ion | Fe | 2 |
Water and common crystallization additives (UNL, CL) are not listed.
Primary citation
Structures of the intermediates of Kok's photosynthetic water oxidation clock. Kern, J., Chatterjee, R., Young, I.D. et al. Nature (2018) 563:421-425. DOI 10.1038/s41586-018-0681-2 · PubMed
Other PDB entries of the same protein (UniProt P0A444 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 5OJ5 1.08 Å, YCF48 bound to D1 peptide
- 9EVX 1.71 Å, cryoEM structure of Photosystem II averaged across S2-S3 states at 1.71 Angstrom…
- 7RF1 1.89 Å, RT XFEL structure of Photosystem II averaged across all S-states at 1.89 Angstrom…
- 9Z35 1.93 Å, RT XFEL structure of two-flash state of Photosystem II (2F, S3 rich) at 1.93 Angstrom…
- 9Z6A 1.93 Å, RT XFEL structure of the two-flash state of Photosystem II (2F, S3 rich) at 1.93…
- 9Z33 1.97 Å, RT XFEL structure of dark-stable state of Photosystem II (0F, S1 rich) at 1.97 Angstrom…
- 9Z68 1.97 Å, RT XFEL structure of the dark-stable state of Photosystem II (0F, S1 rich) at 1.97…
- 9Z34 1.98 Å, RT XFEL structure of one-flash state of Photosystem II (1F, S2 rich) at 1.98 Angstrom…
- 9Z69 1.98 Å, RT XFEL structure of the one-flash state of Photosystem II (1F, S2 rich) at 1.98…
- 8F4C 2.0 Å, RT XFEL structure of the two-flash state of Photosystem II (2F, S3-rich) at 2.00…
- 8F4I 2.0 Å, RT XFEL structure of Photosystem II 2000 microseconds after the third illumination at…
- 8F4J 2.0 Å, RT XFEL structure of Photosystem II 4000 microseconds after the third illumination at…
Browse structure collections
About this viewer
MolViewer shows 6DHE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.