6DU2: Scp1 D96N

Structure of Scp1 D96N bound to REST-pS861/4 peptide. Determined by X-ray diffraction at 2.5 Å resolution. Released 26 Sept 2018.

Method: X-ray diffraction
Resolution: 2.5 Å
Organisms: Erinaceus europaeus, Homo sapiens
Chains: 4
Atoms: 3,011
Mol. weight: 44.4 kDa
Ligands: MG
Released: 26 Sept 2018

Explore 6DU2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6DU2 contains 26 α-helices and 22 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	82-84	3
α-helix	85-88	4
α-helix	91	1
β-strand	92-95	4	1
β-strand	98	1	2
β-strand	102-105	4	2
β-strand	114-120	7	2
β-strand	123-131	9	2
α-helix	132	1
α-helix	135-145	11
β-strand	147-151	5	1
α-helix	156-166	11
β-strand	172-176	5	1
α-helix	178-180	3
β-strand	182-184	3	3
β-strand	187-189	3	3
α-helix	192-194	3
α-helix	199-201	3
β-strand	202-206	5	1
α-helix	209-212	4
α-helix	216-218	3
β-strand	219-221	3	1
α-helix	233-244	12
α-helix	251-254	4

Chain B: 13 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	82-84	3
α-helix	85-87	3
α-helix	91	1
β-strand	92-95	4	4
β-strand	98	1	5
β-strand	102-105	4	5
β-strand	114-120	7	5
β-strand	123-131	9	5
α-helix	132	1
α-helix	135-145	11
β-strand	147-151	5	4
α-helix	156-166	11
β-strand	172-176	5	4
α-helix	178-180	3
β-strand	182-184	3	6
β-strand	187-189	3	6
α-helix	192-194	3
α-helix	199-201	3
β-strand	202-206	5	4
α-helix	209-212	4
α-helix	216-218	3
β-strand	219-221	3	4
α-helix	233-244	12
α-helix	251-254	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1 isoform X2	A, B	protein	180	Erinaceus europaeus	A0A1S2ZIM2 (AlphaFold model)
REST-pS861/4	C, D	protein	12	Homo sapiens	Q13127 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6DU2_1 carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1 isoform X2 (chains A, B)
QYLLPEAKAQDSDKICVVINLDETLVHSSFKPVNNADFIIPVEIDGVVHQVYVLKRPHVD
EFLQRMGELFECVLFTASLAKYADPVADLLDKWGAFRARLFRESCVFHRGNYVKDLSRLG
RDLRRVLILDNSPASYVFHPDNAVPVASWFDNMSDTELHDLLPFFEQLSRVDDVYSVLRQ

Sequence of entity 2 (C, D), FASTA

>6DU2_2 REST-pS861/4 (chains C, D)
EDLSPPSPPLPK

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	2

Primary citation

Phosphatase activity of small C-terminal domain phosphatase 1 (SCP1) controls the stability of the key neuronal regulator RE1-silencing transcription factor (REST). Burkholder, N.T., Mayfield, J.E., Yu, X. et al. J Biol Chem (2018) 293:16851-16861. DOI 10.1074/jbc.RA118.004722 · PubMed

Browse structure collections

About this viewer

MolViewer shows 6DU2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.