HIV-1 wild type protease with grl-034-17A, (3aS, 5R, 6aR)-2-oxohexahyd cyclopenta[d]-5-oxazolyl urethane with a bicyclic oxazolidinone scaff as the P2 ligand. Determined by X-ray diffraction at 1.22 Å resolution. Released 7 Nov 2018.
Explore 6E9A in 3D Show helices and sheets RCSB PDB PDBe
6E9A contains 3 α-helices and 18 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-3 | 2 | 1 |
| β-strand | 10-15 | 6 | 2 |
| β-strand | 18-24 | 7 | 2 |
| β-strand | 31-33 | 3 | 2 |
| β-strand | 42-49 | 8 | 2 |
| β-strand | 52-66 | 15 | 2 |
| β-strand | 69-77 | 9 | 2 |
| β-strand | 84-85 | 2 | 2 |
| α-helix | 87-90 | 4 | |
| α-helix | 91-93 | 3 | |
| β-strand | 96-98 | 3 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-3 | 2 | 1 |
| β-strand | 10-15 | 6 | 3 |
| β-strand | 18-24 | 7 | 3 |
| β-strand | 32-33 | 2 | 3 |
| β-strand | 43-48 | 6 | 3 |
| β-strand | 53-66 | 14 | 3 |
| β-strand | 69-77 | 9 | 3 |
| β-strand | 84-85 | 2 | 3 |
| α-helix | 87-90 | 4 | |
| β-strand | 96-98 | 3 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Protease | A, B | protein | 99 | Human immunodeficiency virus 1 | P04585 (AlphaFold model) |
>6E9A_1 Protease (chains A, B) PQITLWKRPLVTIKIGGQLKEALLDTGADDTVIEEMSLPGRWKPKMIGGIGGFIKVRQYD QIIIEIAGHKAIGTVLVGPTPVNIIGRNLLTQIGATLNF
| ID | Name | Formula | Copies |
|---|---|---|---|
| J0S | (3aS,5R,6aR)-2-oxohexahydro-2H-cyclopenta[d][1,3]oxazol-5-yl… | C28 H37 N3 O8 S | 1 |
Water and common crystallization additives (NA, FMT, CL) are not listed.
Design and Synthesis of Potent HIV-1 Protease Inhibitors Containing Bicyclic Oxazolidinone Scaffold as the P2 Ligands: Structure-Activity Studies and Biological and X-ray Structural Studies. Ghosh, A.K., Williams, J.N., Ho, R.Y. et al. J Med Chem (2018) 61:9722-9737. DOI 10.1021/acs.jmedchem.8b01227 · PubMed
Other PDB entries of the same protein (UniProt P04585 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6E9A directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.