6EC0: Keratin 1

Crystal structure of the wild-type heterocomplex between coil 1B domains of human intermediate filament proteins keratin 1 (KRT1) and keratin 10 (KRT10). Determined by X-ray diffraction at 2.98 Å resolution. Released 15 May 2019.

Method: X-ray diffraction
Resolution: 2.98 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,774
Mol. weight: 25.57 kDa
Ligands: CD, CO, NI
Released: 15 May 2019

Explore 6EC0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6EC0 contains 2 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	228-327	100

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	196-295	100

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Keratin 1	A	protein	107	Homo sapiens	H6VRG1 (AlphaFold model)
Keratin, type I cytoskeletal 10	B	protein	104	Homo sapiens	P13645 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6EC0_1 Keratin 1 (chains A)
MNLEPYFESFINNLRRRVDQLKSDQSRLDSELKNMQDMVEDYRNKYEDEINKRTNAENEF
VTIKKDVDGAYMTKVDLQAKLDNLQQEIDFLTALYQAELSQMQTQIS

Sequence of entity 2 (B), FASTA

>6EC0_2 Keratin, type I cytoskeletal 10 (chains B)
GSDYSKYYKTIDDLKNQILNLTTDNANILLQIDNARLAADDFRLKYENEVALRQSVEADI
NGLRRVLDELTLTKADLEMQIESLTEELAYLKKNHEEEMKDLRN

Ligands and cofactors

ID	Name	Formula	Copies
CD	Cadmium ion	Cd	4
CO	Cobalt (II) ion	Co	2
NI	Nickel (II) ion	Ni	2

Primary citation

Human keratin 1/10-1B tetramer structures reveal a knob-pocket mechanism in intermediate filament assembly. Eldirany, S.A., Ho, M., Hinbest, A.J. et al. EMBO J (2019) 38. DOI 10.15252/embj.2018100741 · PubMed

Browse structure collections

About this viewer

MolViewer shows 6EC0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.