Crystal structure ASF1-ip2_s. Determined by X-ray diffraction at 2.0 Å resolution. Released 12 Jun 2019.
Explore 6F0F in 3D Show helices and sheets RCSB PDB PDBe
6F0F contains 9 α-helices and 11 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-11 | 8 | 1 |
| β-strand | 16-17 | 2 | 2 |
| α-helix | 21 | 1 | |
| β-strand | 22-30 | 9 | 1 |
| β-strand | 38-45 | 8 | 2 |
| α-helix | 51-53 | 3 | |
| β-strand | 54-62 | 9 | 2 |
| β-strand | 68-76 | 9 | 1 |
| α-helix | 77-79 | 3 | |
| α-helix | 81-83 | 3 | |
| α-helix | 86-89 | 4 | |
| β-strand | 91-101 | 11 | 2 |
| β-strand | 104-117 | 14 | 2 |
| α-helix | 120-124 | 5 | |
| α-helix | 132-134 | 3 | |
| β-strand | 135-139 | 5 | 2 |
| β-strand | 145-148 | 4 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 221-231 | 11 | |
| α-helix | 235-236 | 2 | |
| β-strand | 237-239 | 3 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Histone chaperone ASF1A | A | protein | 158 | Homo sapiens | Q9Y294 (AlphaFold model) |
| ip2_s | B | protein | 29 | Homo sapiens |
>6F0F_1 Histone chaperone ASF1A (chains A) GAMAKVQVNNVVVLDNPSPFYNPFQFEITFECIEDLSEDLEWKIIYVGSAESEEYDQVLD SVLVGPVPAGRHMFVFQADAPNPGLIPDADAVGVTVVLITCTYRGQEFIRVGYYVNNEYT ETELRENPPVKPDFSKLQRNILASNPRVTRFHINWEDN
>6F0F_2 ip2_s (chains B) GAMGTLTPKEAELARRIRGAGGRTLNGFG
Design on a Rational Basis of High-Affinity Peptides Inhibiting the Histone Chaperone ASF1. Bakail, M., Gaubert, A., Andreani, J. et al. Cell Chem Biol (2019) 26:1573-1585.e10. DOI 10.1016/j.chembiol.2019.09.002 · PubMed
Other PDB entries of the same protein (UniProt Q9Y294 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6F0F directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.