6F1D: CUB2 domain of C1r

CUB2 domain of C1r. Determined by X-ray diffraction at 1.95 Å resolution. Released 17 Jan 2018.

Method: X-ray diffraction
Resolution: 1.95 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,031
Mol. weight: 13.48 kDa
Ligands: CA
Released: 17 Jan 2018

Explore 6F1D in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6F1D contains 2 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	179-181	3	1
β-strand	186-189	4	2
α-helix	196-198	3
β-strand	202-208	7	1
β-strand	213-219	7	2
β-strand	224	1	3
β-strand	225	1	4
β-strand	237-242	6	1
β-strand	245-250	6	1
β-strand	252	1	4
α-helix	255-258	4
β-strand	259-260	2	2
β-strand	265-271	7	1
β-strand	280	1	3
β-strand	282-289	8	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Complement C1r subcomponent	A	protein	117	Homo sapiens	P00736 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6F1D_1 Complement C1r subcomponent (chains A)
AECSSELYTEASGYISSLEYPRSYPPDLRCNYSIRVERGLTLHLKFLEPFDIEDHPEVPC
PYDQLQIYANGKNIGEFCGKQRPPDLDTSSNAVDLLFFTDESGDSRGWKLRYTTEII

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	1

Water and common crystallization additives (NA) are not listed.

Primary citation

Structure of the C1r-C1s interaction of the C1 complex of complement activation. Almitairi, J.O.M., Venkatraman Girija, U., Furze, C.M. et al. Proc Natl Acad Sci U S A (2018) 115:768-773. DOI 10.1073/pnas.1718709115 · PubMed

Other PDB entries of the same protein (UniProt P00736 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2QY0 2.6 Å, Active dimeric structure of the catalytic domain of C1r reveals enzyme-product like…
1MD8 2.8 Å, Monomeric structure of the active catalytic domain of complement protease C1r
1GPZ 2.9 Å, The crystal structure of the zymogen catalytic domain of complement protease C1R
9EKE 3.1 Å, Structure of a C1r Zymogen Fragment Bound to SALO, Y51F Mutant
1MD7 3.2 Å, Monomeric structure of the zymogen of complement protease C1r
9EKD 3.28 Å, Structure of a C1r Zymogen Fragment Bound to SALO
7MZT 4.07 Å, Borrelia burgdorferi BBK32-C in complex with an autolytic fragment of human C1r at 4.1A
6F1C 4.2 Å, C1rC1s complex
6F1H 4.5 Å, C1rC1s complex
6F39 5.8 Å, C1r homodimer CUB1-EGF-CUB2
1APQ Structure of the egf-like module of human C1R, NMR, 19 structures

Browse structure collections

About this viewer

MolViewer shows 6F1D directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.