Human JMJD5 (W414C) in complex with Mn(II), NOG and RCCD1 (139-143) (complex-5). Determined by X-ray diffraction at 1.22 Å resolution. Released 4 Apr 2018.
Explore 6F4T in 3D Show helices and sheets RCSB PDB PDBe
6F4T contains 13 α-helices and 18 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 183 | 1 | 1 |
| β-strand | 186-188 | 3 | 2 |
| α-helix | 192-195 | 4 | |
| α-helix | 196-200 | 5 | |
| β-strand | 206-209 | 4 | 2 |
| α-helix | 212-214 | 3 | |
| α-helix | 216-220 | 5 | |
| α-helix | 223-230 | 8 | |
| β-strand | 234-239 | 6 | 3 |
| β-strand | 249-254 | 6 | 3 |
| α-helix | 255-259 | 5 | |
| α-helix | 260-264 | 5 | |
| β-strand | 271-272 | 2 | 3 |
| β-strand | 273-276 | 4 | 2 |
| α-helix | 278-281 | 4 | |
| α-helix | 283-286 | 4 | |
| α-helix | 293-297 | 5 | |
| α-helix | 302-304 | 3 | |
| β-strand | 306-312 | 7 | 2 |
| β-strand | 317-321 | 5 | 1 |
| β-strand | 326-333 | 8 | 2 |
| β-strand | 336-341 | 6 | 1 |
| α-helix | 343-348 | 6 | |
| β-strand | 351 | 1 | 4 |
| β-strand | 360 | 1 | 1 |
| β-strand | 361 | 1 | 4 |
| α-helix | 374-378 | 5 | |
| β-strand | 382-386 | 5 | 1 |
| β-strand | 391-394 | 4 | 2 |
| β-strand | 399-404 | 6 | 1 |
| β-strand | 408-415 | 8 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| JmjC domain-containing protein 5 | A | protein | 255 | Homo sapiens | Q8N371 (AlphaFold model) |
| RCC1 domain-containing protein 1 | B | protein | 5 | Homo sapiens | A6NED2 (AlphaFold model) |
>6F4T_1 JmjC domain-containing protein 5 (chains A) HHHHHHSSGVDLGTENLYFQSTVPRLHRPSLQHFREQFLVPGRPVILKGVADHWPAMQKW SLEYIQEIAGARTVPVEVGSRYTDEEWSQTLMTVNEFISKYIVNEPRDVGYLAQHQLFDQ IPELKQDISIPDYCSLGDGEEEEITINAWFGPQGTISPLHQDPQQNFLVQVMGRKYIRLY SPQESGALYPHDTHLLHNTSQVDVENPDLEKFPKFAKAPFLSCILSPGEILFIPVKYWHY VRALDLSFSVSFCWS
>6F4T_2 RCC1 domain-containing protein 1 (chains B) CARAY
Water and common crystallization additives (TRS, GOL) are not listed.
JMJD5 is a human arginyl C-3 hydroxylase. Wilkins, S.E., Islam, S., Gannon, J.M. et al. Nat Commun (2018) 9:1180-1180. DOI 10.1038/s41467-018-03410-w · PubMed
Other PDB entries of the same protein (UniProt Q8N371 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6F4T directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.