6F7U: Adenylate kinase

Molecular Mechanism of ATP versus GTP Selectivity of Adenylate Kinase. Determined by X-ray diffraction at 1.4 Å resolution. Released 14 Mar 2018.

Method: X-ray diffraction
Resolution: 1.4 Å
Organism: Escherichia coli K-12
Chains: 1
Atoms: 2,094
Mol. weight: 24.17 kDa
Ligands: MG, GCP
Released: 14 Mar 2018

Explore 6F7U in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6F7U contains 14 α-helices and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	2-7	6	1
α-helix	13-16	4
α-helix	17-24	8
β-strand	28-29	2	1
α-helix	31-41	11
α-helix	44-54	11
α-helix	58-60	3
α-helix	61-72	12
α-helix	75-77	3
β-strand	81-84	4	1
α-helix	90-99	10
β-strand	105-110	6	1
α-helix	113-121	9
β-strand	123-126	4	2
β-strand	131-134	4	2
β-strand	138	1	2
β-strand	142	1	3
β-strand	145	1	3
α-helix	151	1
β-strand	152	1	3
α-helix	153	1
β-strand	154	1	2
α-helix	157-159	3
α-helix	161-187	27
β-strand	192-197	6	1
α-helix	202-213	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Adenylate kinase	A	protein	214	Escherichia coli K-12	P69441 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6F7U_1 Adenylate kinase (chains A)
MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLVT
DELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRI
VGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEETVRKRLVEYHQMTAPLIG
YYSKEAEAGNTKYAKVDGTKPVAEVRADLEKILG

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	1
GCP	Phosphomethylphosphonic acid guanylate ester	C11 H18 N5 O13 P3	1

Primary citation

Molecular mechanism of ATP versus GTP selectivity of adenylate kinase. Rogne, P., Rosselin, M., Grundstrom, C. et al. Proc Natl Acad Sci U S A (2018) 115:3012-3017. DOI 10.1073/pnas.1721508115 · PubMed

Other PDB entries of the same protein (UniProt P69441 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7APU 1.36 Å, Structure of Adenylate kinase from Escherichia coli in complex with two ADP molecules…
8CRG 1.49 Å, E. coli adenylate kinase in complex with two ADP molecules as a result of enzymatic AP4A…
8RJ9 1.59 Å, E. coli adenylate kinase Asp84Ala variant in complex with two ADP molecules as a result…
6S36 1.6 Å, Crystal structure of E. coli Adenylate kinase R119K mutant
9R71 1.61 Å, Crystal structure of E. coli Adenylate kinase E114A mutant in complex with inhibitor Ap5a.
6RZE 1.69 Å, Crystal structure of E. coli Adenylate kinase R119A mutant
4X8L 1.7 Å, Crystal structure of E. coli Adenylate kinase P177A mutant in complex with inhibitor Ap5a
8Q2B 1.76 Å, E. coli Adenylate Kinase variant D158A (AK D158A) showing significant changes to the…
9R6U 1.77 Å, Crystal structure of E. coli Adenylate kinase K47A mutant in complex with inhibitor Ap5A
1E4V 1.85 Å, Mutant G10V of adenylate kinase from E. coli, modified in the Gly-loop
1E4Y 1.85 Å, Mutant P9L of adenylate kinase from E. coli, modified in the Gly-loop
9L14 1.86 Å, Crystal structure of the monobody CL-1 in complex with the Escherichia coli adenylate…

Browse structure collections

About this viewer

MolViewer shows 6F7U directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.