6FHP: DAIP

DAIP in complex with a C-terminal fragment of thermolysin. Determined by X-ray diffraction at 1.7 Å resolution. Released 12 Sept 2018.

Method: X-ray diffraction
Resolution: 1.7 Å
Organisms: Streptomyces mobaraensis, Geobacillus stearothermophilus
Chains: 4
Atoms: 6,943
Mol. weight: 84.34 kDa
Released: 12 Sept 2018

Explore 6FHP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6FHP contains 11 α-helices and 73 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 36 β-strands

Element	Residues	Length	Sheet
β-strand	15	1	1
β-strand	16	1	2
β-strand	21-24	4	3
β-strand	34	1	1
β-strand	42	1	4
β-strand	46-49	4	5
β-strand	56-60	5	5
β-strand	63-67	5	5
β-strand	73	1	2
β-strand	75-79	5	5
β-strand	86-90	5	6
β-strand	94-98	5	6
β-strand	105-109	5	6
β-strand	112-115	4	6
β-strand	123-128	6	7
β-strand	136-140	5	7
β-strand	145-148	4	7
β-strand	156-158	3	7
β-strand	169-175	7	8
β-strand	178-186	9	8
β-strand	189	1	9
β-strand	190-194	5	8
β-strand	202-203	2	8
β-strand	205	1	10
β-strand	215-222	8	9
β-strand	230-236	7	9
β-strand	249-254	6	9
β-strand	260	1	10
β-strand	262-266	5	9
β-strand	279-281	3	11
β-strand	288-295	8	11
α-helix	297-299	3
β-strand	301-308	8	11
β-strand	313-319	7	11
β-strand	323-329	7	3
β-strand	337-342	6	3
β-strand	343	1	4

Chain B: 2 helices, 37 β-strands

Element	Residues	Length	Sheet
β-strand	15	1	12
β-strand	16	1	13
β-strand	21-24	4	14
β-strand	34	1	12
α-helix	38-39	2
β-strand	42	1	15
β-strand	46-49	4	16
β-strand	56-60	5	16
β-strand	63-67	5	16
β-strand	73	1	13
β-strand	75-79	5	16
β-strand	86-90	5	17
β-strand	94-98	5	17
β-strand	100	1	18
β-strand	105-109	5	17
β-strand	112-115	4	17
β-strand	123-128	6	18
β-strand	136-140	5	18
β-strand	145-148	4	18
β-strand	156-158	3	18
β-strand	169-175	7	19
β-strand	178-186	9	19
β-strand	189	1	20
β-strand	190-194	5	19
β-strand	202-203	2	19
β-strand	205	1	21
β-strand	215-222	8	20
β-strand	230-236	7	20
β-strand	249-254	6	20
β-strand	260	1	21
β-strand	262-266	5	20
β-strand	279-281	3	22
β-strand	288-295	8	22
α-helix	297-299	3
β-strand	301-308	8	22
β-strand	313-319	7	22
β-strand	323-329	7	14
β-strand	337-342	6	14
β-strand	343	1	15

Chain C: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	260-269	10
α-helix	270-274	5
α-helix	281-296	16
α-helix	301-312	12

Chain D: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	260-269	10
α-helix	270-274	5
α-helix	281-296	16
α-helix	301-311	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Dispase autolysis-inducing protein	A, B	protein	342	Streptomyces mobaraensis	P84908 (AlphaFold model)
Thermolysin	C, D	protein	62	Geobacillus stearothermophilus	P43133 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6FHP_1 Dispase autolysis-inducing protein (chains A, B)
SGWRAPSCTKVTGDGAVTFTTDDGATLAPTTGTLQSVSYTHGLVALDTPNTLLATHNDEL
QRSTDAGCTWTKVATLGSGSTWLTAATGGRAFAWEKNGGYLARVDGRTVTKLSSPSADIV
GVGTDKARRDHVRLAGSDGQLYDSTDAGATWKPLGKLAFGPGASVYTVSFDPADLDHAVA
GGMTTGGAVTTDGGATWTAATGLSATAGGKSNLFAASVSPADRNVVYALGIDLVEAAPNS
GAEGRHLYRSTDGGRTYTRIVDDTPDTELTNSTLLAPSPVDPNVLYFEYGTYFQAYGTDL
YRYDARTGKVGKTHNAHDGISAIAFNPARPSVMYLGLEEVQI

Sequence of entity 2 (C, D), FASTA

>6FHP_2 Thermolysin (chains C, D)
VVGIGRDKLGKIFYRALTQYLTPTSNFSQLRAAAVQSATDLYGSTSQEVASVKQAFDAVG
VK

Primary citation

Destructive twisting of neutral metalloproteases: the catalysis mechanism of the Dispase autolysis-inducing protein from Streptomyces mobaraensis DSM 40487. Fiebig, D., Storka, J., Roeder, M. et al. FEBS J (2018) 285:4246-4264. DOI 10.1111/febs.14647 · PubMed

Other PDB entries of the same protein (UniProt P84908 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5FZP 1.7 Å, Structure of the dispase autolysis inducing protein from Streptomyces mobaraensis

Browse structure collections

About this viewer

MolViewer shows 6FHP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.