Crystal structure of N2C/D282C stabilized opsin bound to RS06. Determined by X-ray diffraction at 2.62 Å resolution. Released 4 Apr 2018.
Explore 6FK7 in 3D Show helices and sheets RCSB PDB PDBe
6FK7 contains 17 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-6 | 3 | 1 |
| β-strand | 9-11 | 3 | 1 |
| α-helix | 34-64 | 31 | |
| α-helix | 66-68 | 3 | |
| α-helix | 71-73 | 3 | |
| α-helix | 74-84 | 11 | |
| α-helix | 85-92 | 8 | |
| α-helix | 93-98 | 6 | |
| α-helix | 106-140 | 35 | |
| α-helix | 150-168 | 19 | |
| α-helix | 170-173 | 4 | |
| β-strand | 178-181 | 4 | 2 |
| β-strand | 186-189 | 4 | 2 |
| α-helix | 200-208 | 9 | |
| α-helix | 209-213 | 5 | |
| α-helix | 214-235 | 22 | |
| α-helix | 241-276 | 36 | |
| α-helix | 289-295 | 7 | |
| α-helix | 298-303 | 6 | |
| α-helix | 304-308 | 5 | |
| α-helix | 311-321 | 11 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Rhodopsin | A | protein | 349 | Bos taurus | P02699 (AlphaFold model) |
>6FK7_1 Rhodopsin (chains A) XMCGTEGPNFYVPFSNKTGVVRSPFEAPQYYLAEPWQFSMLAAYMFLLIMLGFPINFLTL YVTVQHKKLRTPLNYILLNLAVADLFMVFGGFTTTLYTSLHGYFVFGPTGCNLEGFFATL GGEIALWSLVVLAIERYVVVCKPMSNFRFGENHAIMGVAFTWVMALACAAPPLVGWSRYI PEGMQCSCGIDYYTPHEETNNESFVIYMFVVHFIIPLIVIFFCYGQLVFTVKEAAAQQQE SATTQKAEKEVTRMVIIMVIAFLICWLPYAGVAFYIFTHQGSCFGPIFMTIPAFFAKTSA VYNPVIYIMMNKQFRNCMVTTLCCGKNPLGDDEASTTVSKTETSQVAPA
| ID | Name | Formula | Copies |
|---|---|---|---|
| DO5 | (2~{R},3~{R})-2-(4-chlorophenyl)-3-oxidanyl-1-spiro[1,3-benzodioxole-2,4'-piper… | C21 H22 Cl N O4 | 1 |
| BOG | octyl beta-D-glucopyranoside | C14 H28 O6 | 5 |
| PLM | Palmitic acid | C16 H32 O2 | 1 |
Ligand channel in pharmacologically stabilized rhodopsin. Mattle, D., Kuhn, B., Aebi, J. et al. Proc Natl Acad Sci U S A (2018) 115:3640-3645. DOI 10.1073/pnas.1718084115 · PubMed
Other PDB entries of the same protein (UniProt P02699 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6FK7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.