6FV0: TPR domain of KLC1

Crystal structure of the TPR domain of KLC1 in complex with the C-terminal peptide of torsinA. Determined by X-ray diffraction at 2.29 Å resolution. Released 28 Mar 2018.

Method: X-ray diffraction
Resolution: 2.29 Å
Organisms: Mus musculus, Lama glama
Chains: 2
Atoms: 3,137
Mol. weight: 50.95 kDa
Released: 28 Mar 2018

Explore 6FV0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6FV0 contains 17 α-helices and 10 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 0 β-strands

Element	Residues	Length
α-helix	215-225	11
α-helix	229-246	18
α-helix	252-267	16
α-helix	271-288	18
α-helix	294-309	16
α-helix	313-331	19
α-helix	336-350	15
α-helix	358-372	15
α-helix	378-393	16
α-helix	397-415	19
α-helix	426-435	10
α-helix	461-476	16
α-helix	480-494	15
α-helix	709-711	3

Chain F: 3 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	1
β-strand	10-12	3	2
β-strand	18-25	8	1
α-helix	29-31	3
β-strand	34-39	6	2
β-strand	46-51	6	2
β-strand	58-60	3	2
α-helix	62-64	3
β-strand	68-73	6	1
β-strand	78-83	6	1
α-helix	88-90	3
β-strand	92-97	6	2
β-strand	109-113	5	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Kinesin light chain 1,Torsin-1A	A	protein	338	Mus musculus	O88447 (AlphaFold model), Q9ER39 (AlphaFold model)
nanobody	F	protein	121	Lama glama

Sequence of entity 1 (A), FASTA

>6FV0_1 Kinesin light chain 1,Torsin-1A (chains A)
GSHMGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNI
LALVYRDQNKYKDAANLLNDALAIREKTLGRDHPAVAATLNNLAVLYGKRGKYKEAEPLC
KRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYEEVEYYYQRALGIYQTKLGPDDPNV
AKTKNNLASCYLKQGKFKQAETLYKEILTRAHEREFGSVDDENKPIWMHAEEREECKGKQ
KDGSAFGEYGGWYKACKVDSPTVTTTLKNLGALYRRQGKFEAAETLEEAAMRSRKQTGST
GSTGSTGSTGSTGSTGSTGSTGSTGSTVFTKLDYYLDD

Sequence of entity 2 (F), FASTA

>6FV0_2 nanobody (chains F)
QVQLQESGGGLVQPGGSLRLSCAASGFAFSSYWMYWVRQAPEKGLEWVSTINTGGGITYY
KDSVKGRFTVSRDNAKNTLYLQMNSLKPEDAAQYYCATDMSGTYRGQGTQVTVSSHHHHH
H

Primary citation

Structural basis for isoform-specific kinesin-1 recognition of Y-acidic cargo adaptors. Pernigo, S., Chegkazi, M.S., Yip, Y.Y. et al. Elife (2018) 7. DOI 10.7554/eLife.38362 · PubMed

Other PDB entries of the same protein (UniProt O88447 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6FUZ 2.7 Å, Crystal structure of the TPR domain of KLC1 in complex with the C-terminal peptide of JIP1

Browse structure collections

About this viewer

MolViewer shows 6FV0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.