Crystal structure of haspin F605T mutant in complex with 5-iodotubercidin. Determined by X-ray diffraction at 1.43 Å resolution. Released 18 Apr 2018.
Explore 6G3A in 3D Show helices and sheets RCSB PDB PDBe
6G3A contains 20 α-helices and 20 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 473 | 1 | 1 |
| α-helix | 475-478 | 4 | |
| α-helix | 481-485 | 5 | |
| β-strand | 488-493 | 6 | 1 |
| β-strand | 496-503 | 8 | 1 |
| β-strand | 506-515 | 10 | 1 |
| β-strand | 520-521 | 2 | 2 |
| β-strand | 524-525 | 2 | 2 |
| α-helix | 526 | 1 | |
| β-strand | 527 | 1 | 1 |
| α-helix | 528 | 1 | |
| α-helix | 529-544 | 16 | |
| α-helix | 545-547 | 3 | |
| β-strand | 552 | 1 | 3 |
| β-strand | 556 | 1 | 4 |
| α-helix | 557-558 | 2 | |
| β-strand | 559-566 | 8 | 1 |
| α-helix | 569-570 | 2 | |
| α-helix | 571-583 | 13 | |
| α-helix | 589-590 | 2 | |
| β-strand | 599-606 | 8 | 1 |
| β-strand | 610-611 | 2 | 4 |
| α-helix | 613-615 | 3 | |
| α-helix | 622-643 | 22 | |
| β-strand | 646 | 1 | 5 |
| α-helix | 652-654 | 3 | |
| β-strand | 655-659 | 5 | 4 |
| β-strand | 664-669 | 6 | 3 |
| β-strand | 672-677 | 6 | 3 |
| β-strand | 681-685 | 5 | 4 |
| β-strand | 692 | 1 | 5 |
| β-strand | 693-695 | 3 | 6 |
| β-strand | 698-700 | 3 | 6 |
| α-helix | 709-711 | 3 | |
| α-helix | 717-729 | 13 | |
| α-helix | 739-754 | 16 | |
| α-helix | 765-780 | 16 | |
| α-helix | 781-783 | 3 | |
| α-helix | 787-793 | 7 | |
| α-helix | 795-797 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Serine/threonine-protein kinase haspin | A | protein | 357 | Homo sapiens | Q8TF76 (AlphaFold model) |
>6G3A_1 Serine/threonine-protein kinase haspin (chains A) MHHHHHHSSGVDLGTENLYFQSMGECSQKGPVPFSHCLPTEKLQRCEKIGEGVFGEVFQT IADHTPVAIKIIAIEGPDLVNGSHQKTFEEILPEIIISKELSLLSGEVCNRTEGFIGLNS VHCVQGSYPPLLLKAWDHYNSTKGSANDRPDFFKDDQLFIVLETEFGGIDLEQMRTKLSS LATAKSILHQLTASLAVAEASLRFEHRDLHWGNVLLKKTSLKKLHYTLNGKSSTIPSCGL QVSIIDYTLSRLERDGIVVFCDVSMDEDLFTGDGDYQFDIYRLMKKENNNRWGEYHPYSN VLWLHYLTDKMLKQMTFKTKCNTPAMKQIKRKIQEFHRTMLNFSSATDLLCQHSLFK
| ID | Name | Formula | Copies |
|---|---|---|---|
| PO4 | Phosphate ion | O4 P | 1 |
| 5ID | (2R,3R,4S,5R)-2-(4-amino-5-iodo-7H-PYRROLO[2,3-d]pyrimidin-7-yl)-5-(hydroxymeth… | C11 H13 I N4 O4 | 1 |
Water and common crystallization additives (DMS, IOD) are not listed.
Halogen-Aromatic pi Interactions Modulate Inhibitor Residence Times. Heroven, C., Georgi, V., Ganotra, G.K. et al. Angew Chem Int Ed Engl (2018) 57:7220-7224. DOI 10.1002/anie.201801666 · PubMed
Other PDB entries of the same protein (UniProt Q8TF76 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6G3A directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.