6GBU: Second SH3 domain of FCHSD2

Crystal structure of the second SH3 domain of FCHSD2 (SH3-2) in complex with the fourth SH3 domain of ITSN1 (SH3d). Determined by X-ray diffraction at 3.44 Å resolution. Released 13 Jun 2018.

Method: X-ray diffraction
Resolution: 3.44 Å
Organism: Homo sapiens
Chains: 8
Atoms: 3,581
Mol. weight: 57.21 kDa
Released: 13 Jun 2018

Explore 6GBU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6GBU contains 7 α-helices and 67 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and C: 1 helix, 8 β-strands

Element	Residues	Length	Sheet
β-strand	5-8	4	1
β-strand	12	1	2
β-strand	19	1	1
β-strand	22	1	2
β-strand	27-32	6	1
β-strand	41-46	6	1
β-strand	49-54	6	1
α-helix	55-57	3
β-strand	58-60	3	1

Chains B, D, F and H: 1 helix, 8 β-strands

Element	Residues	Length	Sheet
β-strand	5-8	4	3
β-strand	12	1	4
β-strand	19	1	3
β-strand	22	1	4
β-strand	27-33	7	3
β-strand	38-44	7	3
β-strand	52-56	5	3
α-helix	57-59	3
β-strand	60-63	4	3

Chain E: 0 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	7	1	13
β-strand	12	1	14
β-strand	19	1	15
β-strand	22	1	14
β-strand	27	1	13
β-strand	29-30	2	16
β-strand	44-46	3	16
β-strand	49-51	3	16
β-strand	52	1	15

Chain G: 1 helix, 10 β-strands

Element	Residues	Length	Sheet
β-strand	7	1	17
β-strand	8	1	18
β-strand	12	1	19
β-strand	19	1	20
β-strand	22	1	19
β-strand	27	1	17
β-strand	29-32	4	20
β-strand	41-46	6	20
β-strand	49-54	6	20
α-helix	55-57	3
β-strand	58	1	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
F-BAR and double SH3 domains protein 2	A, C, E, G	protein	63	Homo sapiens	O94868 (AlphaFold model)
Intersectin-1	B, D, F, H	protein	65	Homo sapiens	Q15811 (AlphaFold model)

Sequence of entity 1 (A, C, E, G), FASTA

>6GBU_1 F-BAR and double SH3 domains protein 2 (chains A, C, E, G)
ASVCFVKALYDYEGQTDDELSFPEGAIIRILNKENQDDDGFWEGEFNGRIGVFPSVLVEE
LSA

Sequence of entity 2 (B, D, F, H), FASTA

>6GBU_2 Intersectin-1 (chains B, D, F, H)
KKPEIAQVIASYTATGPEQLTLAPGQLILIRKKNPGGWWEGELQARGKKRQIGWFPANYV
KLLSP

Primary citation

A Flat BAR Protein Promotes Actin Polymerization at the Base of Clathrin-Coated Pits. Almeida-Souza, L., Frank, R.A.W., Garcia-Nafria, J. et al. Cell (2018) 174:325-337.e14. DOI 10.1016/j.cell.2018.05.020 · PubMed

Other PDB entries of the same protein (UniProt O94868 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2DL5 Solution structure of the first SH3 domain of human KIAA0769 protein
2DL7 Solution structure of the second SH3 domain of human KIAA0769 protein

Browse structure collections

About this viewer

MolViewer shows 6GBU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.