X-ray structure of TEAD4(E263A+Y429F mutant) complexed with YAP(wildtype): The role of residual flexibility and water molecules in the adaptation of a bound intrinsically disordered protein to mutations at a binding interface. Determined by X-ray diffraction at 1.8 Å resolution. Released 19 Sept 2018.
Explore 6GE6 in 3D Show helices and sheets RCSB PDB PDBe
6GE6 contains 11 α-helices and 15 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 217 | 1 | 1 |
| β-strand | 219-220 | 2 | 2 |
| β-strand | 225-238 | 14 | 2 |
| β-strand | 241-250 | 10 | 2 |
| β-strand | 257 | 1 | 1 |
| β-strand | 264-266 | 3 | 3 |
| α-helix | 267-269 | 3 | |
| α-helix | 271-273 | 3 | |
| α-helix | 281-287 | 7 | |
| α-helix | 290-292 | 3 | |
| β-strand | 293-300 | 8 | 3 |
| β-strand | 312-322 | 11 | 2 |
| β-strand | 327-336 | 10 | 3 |
| β-strand | 339-349 | 11 | 3 |
| β-strand | 351-353 | 3 | 2 |
| β-strand | 356-365 | 10 | 2 |
| α-helix | 366-367 | 2 | |
| α-helix | 368-378 | 11 | |
| α-helix | 383-390 | 8 | |
| β-strand | 393-401 | 9 | 3 |
| β-strand | 407-417 | 11 | 3 |
| β-strand | 425-432 | 8 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 65-73 | 9 | |
| α-helix | 75-77 | 3 | |
| α-helix | 86-88 | 3 | |
| α-helix | 93-95 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Transcriptional enhancer factor TEF-3 | A | protein | 219 | Homo sapiens | Q15561 (AlphaFold model) |
| Transcriptional coactivator YAP1 | L | protein | 41 | Homo sapiens | P46937 (AlphaFold model) |
>6GE6_1 Transcriptional enhancer factor TEF-3 (chains A) GRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLAAVDIRQIYDKFP EKKGGLKDLFERGPSNAFFLVKFWADLNTNIEDEGSSFYGVSSQYESPENMIITCSTKVC SFGKQVVEKVETEYARYENGHYSYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTI LQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIFRLVKE
>6GE6_2 Transcriptional coactivator YAP1 (chains L) DSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPE
Adaptation of the bound intrinsically disordered protein YAP to mutations at the YAP:TEAD interface. Mesrouze, Y., Bokhovchuk, F., Izaac, A. et al. Protein Sci (2018) 27:1810-1820. DOI 10.1002/pro.3493 · PubMed
Other PDB entries of the same protein (UniProt Q15561 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6GE6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.