TEAD4 (216-434);Y429F complexed with yap peptide (60-100) and myristoate (covalently bound) at 2.28A (P212121 crystal form); myristoylation was done by adding myr-CoA. Determined by X-ray diffraction at 2.28 Å resolution. Released 19 Sept 2018.
Explore 6GEK in 3D Show helices and sheets RCSB PDB PDBe
6GEK contains 21 α-helices and 26 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 220 | 1 | 1 |
| β-strand | 225-238 | 14 | 1 |
| β-strand | 241-250 | 10 | 1 |
| β-strand | 264-266 | 3 | 2 |
| α-helix | 267-269 | 3 | |
| α-helix | 271-273 | 3 | |
| α-helix | 281-287 | 7 | |
| α-helix | 290-292 | 3 | |
| β-strand | 293-300 | 8 | 2 |
| β-strand | 312-322 | 11 | 1 |
| β-strand | 327-336 | 10 | 2 |
| β-strand | 339-349 | 11 | 2 |
| β-strand | 351-353 | 3 | 1 |
| β-strand | 356-365 | 10 | 1 |
| α-helix | 366-367 | 2 | |
| α-helix | 368-378 | 11 | |
| α-helix | 383-390 | 8 | |
| β-strand | 393-401 | 9 | 2 |
| β-strand | 407-417 | 11 | 2 |
| β-strand | 425-432 | 8 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 220 | 1 | 1 |
| β-strand | 225-236 | 12 | 1 |
| β-strand | 241-250 | 10 | 1 |
| α-helix | 259-261 | 3 | |
| β-strand | 263-266 | 4 | 3 |
| α-helix | 267-269 | 3 | |
| α-helix | 271-273 | 3 | |
| α-helix | 281-287 | 7 | |
| α-helix | 290-292 | 3 | |
| β-strand | 293-300 | 8 | 3 |
| β-strand | 311-322 | 12 | 1 |
| β-strand | 328-336 | 9 | 3 |
| β-strand | 339-348 | 10 | 3 |
| β-strand | 351-353 | 3 | 1 |
| β-strand | 356-365 | 10 | 1 |
| α-helix | 366-367 | 2 | |
| α-helix | 368-379 | 12 | |
| α-helix | 383-390 | 8 | |
| β-strand | 393-401 | 9 | 3 |
| β-strand | 407-417 | 11 | 3 |
| β-strand | 425-432 | 8 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 61-73 | 13 | |
| α-helix | 86-88 | 3 | |
| α-helix | 93-95 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 63-67 | 5 | |
| α-helix | 86-88 | 3 | |
| α-helix | 93-95 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Transcriptional enhancer factor TEF-3 | A, B | protein | 219 | Homo sapiens | Q15561 (AlphaFold model) |
| Transcriptional coactivator YAP1 | L, M | protein | 41 | Homo sapiens | P46937 (AlphaFold model) |
>6GEK_1 Transcriptional enhancer factor TEF-3 (chains A, B) GRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLEAVDIRQIYDKFP EKKGGLKDLFERGPSNAFFLVKFWADLNTNIEDEGSSFYGVSSQYESPENMIITCSTKVC SFGKQVVEKVETEYARYENGHYSYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTI LQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIFRLVKE
>6GEK_2 Transcriptional coactivator YAP1 (chains L, M) DSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPE
| ID | Name | Formula | Copies |
|---|---|---|---|
| MYR | Myristic acid | C14 H28 O2 | 2 |
Adaptation of the bound intrinsically disordered protein YAP to mutations at the YAP:TEAD interface. Mesrouze, Y., Bokhovchuk, F., Izaac, A. et al. Protein Sci (2018) 27:1810-1820. DOI 10.1002/pro.3493 · PubMed
Other PDB entries of the same protein (UniProt Q15561 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6GEK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.