6GF2: Ubiquitin D

The structure of the ubiquitin-like modifier FAT10 reveals a novel targeting mechanism for degradation by the 26S proteasome. Determined by solution NMR. Released 8 Aug 2018.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 647
Mol. weight: 9.26 kDa
Released: 8 Aug 2018

Explore 6GF2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6GF2 contains 3 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	8	1	1
β-strand	10-14	5	2
β-strand	21-23	3	2
β-strand	26	1	1
β-strand	31	1	3
α-helix	32-42	11
α-helix	47-49	3
β-strand	50-53	4	2
β-strand	58	1	2
β-strand	64	1	3
α-helix	65-68	4
β-strand	74-80	7	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ubiquitin D	A	protein	85	Homo sapiens	O15205 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6GF2_1 Ubiquitin D (chains A)
GAMGDEELPLFLVESGDEAKRHLLQVRRSSSVAQVKAMIETKTGIIPETQIVTLNGKRLE
DGKMMADYGIRKGNLLFLASYSIGG

Primary citation

The structure of the ubiquitin-like modifier FAT10 reveals an alternative targeting mechanism for proteasomal degradation. Aichem, A., Anders, S., Catone, N. et al. Nat Commun (2018) 9:3321-3321. DOI 10.1038/s41467-018-05776-3 · PubMed

Other PDB entries of the same protein (UniProt O15205 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6GF1 1.93 Å, The structure of the ubiquitin-like modifier FAT10 reveals a novel targeting mechanism…
28MJ 2.77 Å, Cryo-EM structure of UBA6 in complex with FAT10 in the pre-adenylation state.
28MQ 3.04 Å, Cryo-EM structure of UBA6-FAT10Dha-UBE2Z trapped ternary complex
9E8O 3.1 Å, Nub1/Fat10-processing human 26S proteasome bound to Txnl1 with Rpt2 at top of spiral…
7PYV 3.27 Å, Crystal structure of human UBA6 in complex with the ubiquitin-like modifier FAT10
28MK 3.53 Å, Cryo-EM structure of UBA6 in complex with FAT10 in the post-thiolation state.
2MBE Backbone 1H and 15N Chemical Shift Assignments for the first domain of FAT10

Browse structure collections

About this viewer

MolViewer shows 6GF2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.