6GGO: Salmonella zinc metalloprotease effector GtgA

Crystal structure of Salmonella zinc metalloprotease effector GtgA. Determined by X-ray diffraction at 2.6 Å resolution. Released 29 Aug 2018.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S
Chains: 2
Atoms: 3,243
Mol. weight: 48.4 kDa
Ligands: ZN
Released: 29 Aug 2018

Explore 6GGO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6GGO contains 28 α-helices and 18 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	40-46	7
α-helix	58-60	3
α-helix	61-65	5
β-strand	66-69	4	5
α-helix	77-79	3
α-helix	80-100	21
α-helix	102-111	10
α-helix	112-116	5
α-helix	122	1
β-strand	123-127	5	5
β-strand	132-133	2	5
α-helix	137-142	6
β-strand	148-151	4	5
α-helix	161-163	3
β-strand	164-165	2	6
β-strand	166	1	7
β-strand	172-173	2	6
α-helix	174-175	2
α-helix	176-189	14
α-helix	202-213	12
α-helix	219-220	2
β-strand	223	1	7

Chain B: 14 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	40-46	7
α-helix	58-60	3
α-helix	61-65	5
β-strand	66-69	4	1
α-helix	77-79	3
α-helix	80-100	21
α-helix	102-111	10
α-helix	112-116	5
α-helix	122	1
β-strand	123-127	5	1
β-strand	132-133	2	1
α-helix	137-142	6
β-strand	148-151	4	1
α-helix	161-163	3
β-strand	164-165	2	2
β-strand	166	1	3
β-strand	172-173	2	2
α-helix	174-175	2
α-helix	176-189	14
β-strand	195	1	4
β-strand	198	1	4
α-helix	202-213	12
α-helix	219-220	2
β-strand	223	1	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Bacteriophage virulence determinant	A, B	protein	212	Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S	A0A0F6AZI6 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6GGO_1 Bacteriophage virulence determinant (chains A, B)
GAMSHPHDSKVFPDLPEHQDNPSQLRLQHDGLATDDKARLEPMCLAEYLISGPGGMDPDI
EIDDDTYDECREVLSRILEDAYTQSGTFRRLMNYAYDQELHDVEQRWLLGAGENFGTTVT
DEDLESSEGRKVIALNLDDTDDDSIPEYYESNDGPQQFDTTRSFIHQVVHALTHLQDKED
SNPRGPVVEYTNIILKEMGHTSPPRIAYEFSN

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Water and common crystallization additives (CL) are not listed.

Primary citation

Structure-function analyses of the bacterial zinc metalloprotease effector protein GtgA uncover key residues required for deactivating NF-kappa B. Jennings, E., Esposito, D., Rittinger, K. et al. J Biol Chem (2018) 293:15316-15329. DOI 10.1074/jbc.RA118.004255 · PubMed

Other PDB entries of the same protein (UniProt A0A0F6AZI6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6GGR 2.1 Å, Crystal structure of Salmonella zinc metalloprotease effector GtgA in complex with p65

Browse structure collections

About this viewer

MolViewer shows 6GGO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.