Crystal structure of human KDR (VEGFR2) kinase domain in complex with AZD3229-analogue (compound 18). Determined by X-ray diffraction at 1.87 Å resolution. Released 19 Sept 2018.
Explore 6GQO in 3D Show helices and sheets RCSB PDB PDBe
6GQO contains 22 α-helices and 14 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 813-815 | 3 | |
| α-helix | 817-819 | 3 | |
| α-helix | 824-827 | 4 | |
| β-strand | 828 | 1 | 1 |
| α-helix | 831-833 | 3 | |
| β-strand | 834-839 | 6 | 1 |
| β-strand | 846-854 | 9 | 1 |
| β-strand | 862-870 | 9 | 1 |
| α-helix | 876-892 | 17 | |
| β-strand | 898 | 1 | 2 |
| α-helix | 899-900 | 2 | |
| β-strand | 901-905 | 5 | 1 |
| β-strand | 913-917 | 5 | 1 |
| β-strand | 923 | 1 | 2 |
| α-helix | 924-930 | 7 | |
| β-strand | 935 | 1 | 3 |
| α-helix | 943-946 | 4 | |
| β-strand | 1000 | 1 | 3 |
| α-helix | 1002-1021 | 20 | |
| α-helix | 1031-1033 | 3 | |
| β-strand | 1034-1036 | 3 | 2 |
| α-helix | 1038-1040 | 3 | |
| β-strand | 1042-1044 | 3 | 2 |
| α-helix | 1048-1050 | 3 | |
| β-strand | 1060-1062 | 3 | 4 |
| β-strand | 1065-1067 | 3 | 4 |
| α-helix | 1069-1071 | 3 | |
| α-helix | 1074-1079 | 6 | |
| α-helix | 1084-1099 | 16 | |
| α-helix | 1103-1104 | 2 | |
| α-helix | 1113-1121 | 9 | |
| α-helix | 1125-1128 | 4 | |
| α-helix | 1133-1142 | 10 | |
| α-helix | 1147-1149 | 3 | |
| α-helix | 1151-1152 | 2 | |
| α-helix | 1153-1167 | 15 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Vascular endothelial growth factor receptor 2 | A | protein | 322 | Homo sapiens | P35968 (AlphaFold model) |
>6GQO_1 Vascular endothelial growth factor receptor 2 (chains A) MDPDELPLDEHCERLPYDASKWEFPRDRLKLGKPLGRGAFGQVIEADAFGIDKTATCRTV AVKMLKEGATHSEHRALMSELKILIHIGHHLNVVNLLGACTKPGGPLMVIVEFCKFGNLS TYLRSKRNEFVPYKVAPEDLYKDFLTLEHLICYSFQVAKGMEFLASRKCIHRDLAARNIL LSEKNVVKICDFGLARDIYKDPDYVRKGDARLPLKWMAPETIFDRVYTIQSDVWSFGVLL WEIFSLGASPYPGVKIDEEFCRRLKEGTRMRAPDYTTPEMYQTMLDCWHGEPSQRPTFSE LVEHLGNLLQANAQQDENLYFQ
| ID | Name | Formula | Copies |
|---|---|---|---|
| F82 | 2-[4-(6,7-dimethoxyquinazolin-4-yl)oxy-2-methoxy-phenyl]-~{N}-(1-propan-2-ylpyr… | C25 H27 N5 O5 | 1 |
Discovery of N-(4-{[5-Fluoro-7-(2-methoxyethoxy)quinazolin-4-yl]amino}phenyl)-2-[4-(propan-2-yl)-1 H-1,2,3-triazol-1-yl]acetamide (AZD3229), a Potent Pan-KIT Mutant Inhibitor for the Treatment of Gastrointestinal Stromal Tumors. Kettle, J.G., Anjum, R., Barry, E. et al. J Med Chem (2018) 61:8797-8810. DOI 10.1021/acs.jmedchem.8b00938 · PubMed
Other PDB entries of the same protein (UniProt P35968 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6GQO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.