6GVW: BRCA1-A complex

Crystal structure of the BRCA1-A complex. Determined by X-ray diffraction at 3.75 Å resolution. Released 10 Jul 2019.

Method: X-ray diffraction
Resolution: 3.75 Å
Organism: Mus musculus
Chains: 10
Atoms: 20,138
Mol. weight: 337.21 kDa
Ligands: ZN
Released: 10 Jul 2019

Explore 6GVW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6GVW contains 92 α-helices and 98 β-strands across 10 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	4-5	2	1
β-strand	8-11	4	1
α-helix	12-24	13
β-strand	29-41	13	1
β-strand	55-67	13	1
α-helix	82-90	9
β-strand	96-102	7	1
α-helix	112-124	13
β-strand	131-140	10	1
β-strand	146-158	13	1
β-strand	160-164	5	1
β-strand	166-169	4	1
α-helix	189-197	9
α-helix	210-261	52
α-helix	277-286	10
β-strand	297-299	3	2
β-strand	305-306	2	2
α-helix	315-316	2

Chain B: 9 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	11-15	5	1
α-helix	16-26	11
β-strand	35-44	10	1
β-strand	70-80	11	1
α-helix	94-111	18
β-strand	116-124	9	1
α-helix	131-132	2
α-helix	133-143	11
β-strand	150-158	9	1
β-strand	166-176	11	1
β-strand	185-188	4	1
β-strand	191-194	4	1
α-helix	201-207	7
α-helix	209-225	17
α-helix	233-250	18
α-helix	251-255	5
α-helix	256-289	34

Chain C: 15 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	3-6	4
β-strand	10	1	3
α-helix	15-24	10
β-strand	36-41	6	4
β-strand	53	1	3
β-strand	55-62	8	4
β-strand	65-72	8	4
β-strand	83-85	3	4
α-helix	100-103	4
α-helix	112-133	22
α-helix	139-146	8
α-helix	149-152	4
β-strand	155-159	5	5
α-helix	160-163	4
β-strand	171-176	6	5
α-helix	184-186	3
β-strand	195	1	6
β-strand	201-207	7	5
β-strand	215-221	7	5
α-helix	223-228	6
α-helix	232-234	3
α-helix	238-240	3
α-helix	246-282	37
α-helix	283-285	3
β-strand	286-289	4	7
β-strand	296-303	8	7
β-strand	306-313	8	7
α-helix	322-323	2
β-strand	324-333	10	7
β-strand	339-344	6	7
α-helix	355-380	26
β-strand	382	1	7

Chain D: 10 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	86-88	3	2
β-strand	97-104	8	8
α-helix	107-110	4
β-strand	114-116	3	9
β-strand	120-122	3	9
α-helix	124-141	18
β-strand	147-153	7	8
β-strand	158-164	7	8
α-helix	168-174	7
α-helix	187-197	11
α-helix	199-201	3
β-strand	214-221	8	8
α-helix	234-241	8
β-strand	245-253	9	8
α-helix	255-258	4
α-helix	262-273	12
β-strand	283-287	5	8
α-helix	293-301	9
α-helix	312-314	3

Chain E: 3 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	273-276	4	2
α-helix	289-311	23
β-strand	317	1	6
α-helix	322-323	2
β-strand	324	1	5
α-helix	325-328	4

Chain F: 7 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	4-5	2	10
β-strand	8-11	4	10
α-helix	12-24	13
β-strand	29-45	17	10
β-strand	51-67	17	10
α-helix	82-90	9
β-strand	96-102	7	10
α-helix	112-125	14
β-strand	131-139	9	10
β-strand	146-156	11	10
β-strand	161-164	4	10
β-strand	166-169	4	10
α-helix	189-197	9
α-helix	210-261	52
α-helix	277-285	9
α-helix	288-293	6
β-strand	297-299	3	11
β-strand	305	1	11

Chain G: 9 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	11-15	5	10
α-helix	16-26	11
β-strand	35-44	10	10
β-strand	70-80	11	10
α-helix	94-111	18
β-strand	116-124	9	10
α-helix	131-132	2
α-helix	133-145	13
β-strand	150-158	9	10
β-strand	166-177	12	10
β-strand	184-188	5	10
β-strand	191-194	4	10
α-helix	201-207	7
α-helix	209-227	19
α-helix	233-250	18
α-helix	251-255	5
α-helix	256-288	33

Chain H: 17 helices, 18 β-strands

Element	Residues	Length	Sheet
α-helix	3-6	4
β-strand	10	1	12
α-helix	12-14	3
α-helix	15-24	10
β-strand	36-41	6	13
β-strand	53	1	12
β-strand	55-62	8	13
β-strand	65-72	8	13
β-strand	83-85	3	13
α-helix	100-103	4
α-helix	112-132	21
α-helix	139-146	8
α-helix	149-152	4
β-strand	155-159	5	14
α-helix	160-163	4
β-strand	171-176	6	14
α-helix	181-183	3
α-helix	184-186	3
β-strand	195	1	15
β-strand	201-207	7	14
β-strand	215-221	7	14
α-helix	223-229	7
α-helix	232-234	3
β-strand	236-237	2	16
α-helix	238-240	3
α-helix	246-282	37
α-helix	283-285	3
β-strand	286-289	4	17
β-strand	296-303	8	17
β-strand	306-313	8	17
α-helix	322-323	2
β-strand	324-333	10	17
β-strand	339-344	6	17
α-helix	355-380	26
β-strand	382	1	17

2 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
BRCA1-A complex subunit Abraxas 1	A, F	protein	411	Mus musculus	Q8BPZ8 (AlphaFold model)
Lys-63-specific deubiquitinase BRCC36	B, G	protein	295	Mus musculus	P46737 (AlphaFold model)
BRISC and BRCA1-A complex member 2	C, H	protein	387	Mus musculus	Q8K3W0 (AlphaFold model)
BRISC and BRCA1-A complex member 1	D, I	protein	337	Mus musculus	Q3UI43 (AlphaFold model)
BRCA1-A complex subunit RAP80	E, J	protein	64	Mus musculus	Q5U5Q9

Sequence of entity 1 (A, F), FASTA

>6GVW_1 BRCA1-A complex subunit Abraxas 1 (chains A, F)
GGGRMEGESTLGVLSGFVLGALTFHHLNTDSDTEGFLLGEMKGEAKNSITDSQMDNVKVV
YTIDIQKYIPCYRLFSFYNSLGEVNEHALKKVLSNVRKTVVGWYKFRRHSDQIMTFREQL
LHRNLQTHLSSPELVFLLLTPSITTESCSTHCLEHALYKPQRGLFHRVPLVVTNLGMSDQ
LGYKTEPASCTSTVFSRAVRTHSSQFFNEDGSLKEVHKINEMYAAVQEELKSICQKVEQS
EREVEKLLMDVNQLKEVRRTQQARATGAGEKNVQRNPQENILLCQALRTFFPESEVLHSC
VISLKNRHISPSGCNVNHHVDVVDQLTLMVEYVYSPEASPVPTAQLRKRKALDTHDQGSV
KRPRLLETESRPSVAASRSRHQDKASSSSLDIDIEMGSPEDDADYPRSPTF

Sequence of entity 2 (B, G), FASTA

>6GVW_2 Lys-63-specific deubiquitinase BRCC36 (chains B, G)
GGGRMAVQVVQAVQAVHLESDAFLVCLNHALSTEKEEVMGLCIGELNDDIRSDSKFTYTG
TEMRTVQEKMDTIRIVHIHSVIILRRSDKRKDRVEISPEQLSAASTEAERLAELTGRPMR
VVGWYHSHPHITVWPSHVDVRTQAMYQMMDQGFVGLIFSCFIEDKNTKTGRVLYTCFQSI
QAQKSSEYERIEIPIHIVPHITIGKVCLESAVELPKILCQEEQDAYRRIHSLTHLDSVTK
IHNGSVFTKNLCSQMSAVSGPLLQWLEDRLEQNQQHLQELQQEKEELMEELSSLE

Sequence of entity 3 (C, H), FASTA

>6GVW_3 BRISC and BRCA1-A complex member 2 (chains C, H)
GGGRMSPEIALNRISPMLSPFISSVVRNGKVGLDATNCLRITDLKSGCTSLTPGPNCDRF
KLHIPYAGETLKWDIIFNAQYPELPPDFIFGEDAEFLPDPSALHNLASWNPSNPECLLLV
VKELVQQYHQFQCGRLRESSRLMFEYQTLLEEPQYGENMEIYAGKKNNWTGEFSARFLLK
LPVDFSNIPTYLLKDVNEDPGEDVALLSVSFEDTEATQVYPKLYLSPRIEHALGGSSALH
IPAFPGGGCLIDYVPQVCHLLTNKVQYVIQGYHKRREYIAAFLSHFGTGVVEYDAEGFTK
LTLLLMWKDFCFLVHIDLPLFFPRDQPTLTFQSVYHFTNSGQLYSQAQKNYPYSPRWDGN
EMAKRAKAYFKTFVPQFQEAAFANGKL

Sequence of entity 4 (D, I), FASTA

>6GVW_4 BRISC and BRCA1-A complex member 1 (chains D, I)
GGGRMEVAEANSPTEEEEEEEEEGEETISEPRPHTRSNPEGAEDRALGAQASVGSRSEGE
GEAATADGGAASVPGAGPKPWQVPASASEVQIRTPRVNCPEKVIICLDLSEEMSVPKLES
FNGSRTNALNVSQKMVEMFVRTKHKIDKSHEFALVVVNDDSAWLSGLTSDPRELCSCLYD
LETASCSTFNLEGLFSLIQQKTELPVTENVQTIPPPYVVRTILVYSRPPCQPQFSLTEPM
KKMFQCPYFFFDIVYIHNGTEEKEEDMSWKDMFAFMGSLDTKGASYKYEVALAGPALELH
NCMAKLLAHPLQRPCQTHASYSLLEEDEEAGEEEATV

Sequence of entity 5 (E, J), FASTA

>6GVW_5 BRCA1-A complex subunit RAP80 (chains E, J)
GGGRHYYWGIPFCPAGVDPNQYTNVILCQLEVYQKSLKMAQRQLVKKRGFGEPVLPRPPF
LIQN

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Primary citation

Structural Basis of BRCC36 Function in DNA Repair and Immune Regulation. Rabl, J., Bunker, R.D., Schenk, A.D. et al. Mol Cell (2019) 75:483-497.e9. DOI 10.1016/j.molcel.2019.06.002 · PubMed

Browse structure collections

About this viewer

MolViewer shows 6GVW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.