KSHV PAN RNA Mta-response element fragment complexed with the globular domain of herpesvirus saimiri ORF57. Determined by X-ray diffraction at 1.86 Å resolution. Released 21 Nov 2018.
Explore 6HAU in 3D Show helices and sheets RCSB PDB PDBe
6HAU contains 41 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 146-149 | 4 | |
| β-strand | 151 | 1 | 1 |
| α-helix | 153-155 | 3 | |
| α-helix | 157-158 | 2 | |
| α-helix | 162-163 | 2 | |
| α-helix | 169-177 | 9 | |
| α-helix | 182-191 | 10 | |
| α-helix | 197-200 | 4 | |
| β-strand | 201-203 | 3 | 2 |
| α-helix | 207-218 | 12 | |
| α-helix | 224-236 | 13 | |
| α-helix | 240-259 | 20 | |
| α-helix | 262-264 | 3 | |
| α-helix | 273-275 | 3 | |
| α-helix | 276-289 | 14 | |
| α-helix | 293-296 | 4 | |
| α-helix | 303-316 | 14 | |
| α-helix | 319-326 | 8 | |
| β-strand | 331 | 1 | 3 |
| α-helix | 334-350 | 17 | |
| α-helix | 353-355 | 3 | |
| α-helix | 356-368 | 13 | |
| α-helix | 373-388 | 16 | |
| α-helix | 392-402 | 11 | |
| β-strand | 414-416 | 3 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 146-149 | 4 | |
| β-strand | 151 | 1 | 3 |
| α-helix | 153-155 | 3 | |
| α-helix | 172-177 | 6 | |
| α-helix | 182-191 | 10 | |
| α-helix | 197-200 | 4 | |
| β-strand | 201-203 | 3 | 4 |
| α-helix | 204-206 | 3 | |
| α-helix | 208-218 | 11 | |
| α-helix | 224-236 | 13 | |
| α-helix | 240-259 | 20 | |
| α-helix | 262-264 | 3 | |
| α-helix | 273-275 | 3 | |
| α-helix | 276-289 | 14 | |
| α-helix | 293-296 | 4 | |
| α-helix | 303-316 | 14 | |
| α-helix | 319-326 | 8 | |
| β-strand | 331 | 1 | 1 |
| α-helix | 334-350 | 17 | |
| α-helix | 353-355 | 3 | |
| α-helix | 356-368 | 13 | |
| α-helix | 373-386 | 14 | |
| α-helix | 394-402 | 9 | |
| β-strand | 414-416 | 3 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| mRNA export factor ICP27 homolog | A, B | protein | 273 | Saimiriine herpesvirus 2 (strain 11) | P13199 (AlphaFold model) |
| MRE fragment of PAN RNA | D | RNA | 17 | Human herpesvirus 8 |
>6HAU_1 mRNA export factor ICP27 homolog (chains A, B) GPLLKLFDISILPKSGEPKLFLPVPSLPCQEAEKTNDKYVLAMAQRAMHDVPISSKQLTA NLLPVKFKPLLSIVRYTPNYYYWVSMRKETIASANLCTVAAFLDESLCWGQQYLKNDFIF SENGKDIILDTSSALLSQLVHKIKMLPFCHCLMQTTPQDHIVKQVCYLIASNNRILDAVR YLQTSVIKSPIVLLLAYAVCLPAAIICTKNETQLYSHCMRILKEYRPGDVMNILHESLTQ HLNKCPSSTCAYTTRAIVGTKANTTGLFFLPTQ
>6HAU_2 MRE fragment of PAN RNA (chains D) CACCUAUGGAUUUUGUG
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 2 |
Water and common crystallization additives (ACT) are not listed.
Structural identification of conserved RNA binding sites in herpesvirus ORF57 homologs: implications for PAN RNA recognition. Tunnicliffe, R.B., Levy, C., Ruiz Nivia, H.D. et al. Nucleic Acids Res (2019) 47:1987-2001. DOI 10.1093/nar/gky1181 · PubMed
Other PDB entries of the same protein (UniProt P13199 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6HAU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.