Crystal structure of TOPBP1 BRCT0,1,2 in complex with a RAD9 phosphopeptide. Determined by X-ray diffraction at 2.33 Å resolution. Released 17 Oct 2018.
Explore 6HM5 in 3D Show helices and sheets RCSB PDB PDBe
6HM5 contains 13 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 11-14 | 4 | 1 |
| α-helix | 21-27 | 7 | |
| β-strand | 39-42 | 4 | 1 |
| α-helix | 44-48 | 5 | |
| β-strand | 57-59 | 3 | 1 |
| α-helix | 66-74 | 9 | |
| β-strand | 77-79 | 3 | 1 |
| α-helix | 81-87 | 7 | |
| β-strand | 101 | 1 | 1 |
| β-strand | 110-114 | 5 | 2 |
| α-helix | 118-130 | 13 | |
| β-strand | 134-135 | 2 | 2 |
| β-strand | 139-140 | 2 | 3 |
| β-strand | 145-148 | 4 | 2 |
| α-helix | 154-161 | 8 | |
| β-strand | 166-167 | 2 | 2 |
| α-helix | 169-181 | 13 | |
| α-helix | 186-188 | 3 | |
| α-helix | 191-194 | 4 | |
| β-strand | 195 | 1 | 2 |
| α-helix | 196-197 | 2 | |
| β-strand | 203-207 | 5 | 4 |
| α-helix | 211-223 | 13 | |
| β-strand | 227-228 | 2 | 4 |
| β-strand | 239-242 | 4 | 4 |
| β-strand | 259-261 | 3 | 4 |
| α-helix | 263-272 | 10 | |
| α-helix | 278-281 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 382-384 | 3 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| DNA topoisomerase II binding protein 1 | A | protein | 290 | Gallus gallus | A0A1D5P3M9 |
| Cell cycle checkpoint control protein RAD9A | B | protein | 11 | Homo sapiens | Q99638 (AlphaFold model) |
>6HM5_1 DNA topoisomerase II binding protein 1 (chains A) RMKGSKEVFLVKFVKSSGSSEYFLKALESIKEFQSEEHLQILEEEAALNIKENDKSLYIC DPFTGVVFNHLKKLGCRIVGPQVVLYCMQSQRCVPRAEYPVYNMTMADVTISCTTLDKDV REEVHKYVQMMGGRVYRDLNMSVTHLIAGEVGSKKYLVAASLKKPVLLPSWVKTLWDKSQ QRMMRYTDVNMEDYACPVFLGCTICVTGLSSSDRKEVQRLTAEHGGQYSGQLKMNECTHL IVQEPKGQKYECAKKWNVHCVPVQWFSDSIEKGFCQDETMYKIESGSKLS
>6HM5_2 Cell cycle checkpoint control protein RAD9A (chains B) SPVLAEDSEGE
BRCT domains of the DNA damage checkpoint proteins TOPBP1/Rad4 display distinct specificities for phosphopeptide ligands. Day, M., Rappas, M., Ptasinska, K. et al. Elife (2018) 7. DOI 10.7554/eLife.39979 · PubMed
MolViewer shows 6HM5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.