6HR1: YFPnano fusion protein

Name: PDB 6HR1: Crystal structure of the YFPnano fusion protein
Published: 2020-04-08
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: fusion protein

Crystal structure of the YFPnano fusion protein. Determined by X-ray diffraction at 1.9 Å resolution. Released 8 Apr 2020.

Method: X-ray diffraction
Resolution: 1.9 Å
Organisms: Oryctolagus cuniculus, Bos taurus, Aequorea victoria
Chains: 2
Atoms: 6,986
Mol. weight: 99.94 kDa
Ligands: CA, TLA
Released: 8 Apr 2020

Explore 6HR1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6HR1 contains 31 α-helices and 36 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 18 β-strands

Element	Residues	Length	Sheet
α-helix	-33-6	40
β-strand	11-22	12	1
β-strand	25-36	12	1
β-strand	41-48	8	1
α-helix	57-60	4
α-helix	69-71	3
β-strand	73	1	1
α-helix	76-81	6
α-helix	83-86	4
β-strand	92-100	9	1
β-strand	105-115	11	1
β-strand	118-128	11	1
β-strand	141	1	2
β-strand	148-155	8	1
β-strand	160-170	11	1
β-strand	171	1	2
β-strand	176-187	12	1
α-helix	196-197	2
β-strand	199-208	10	1
β-strand	217-227	11	1
α-helix	258-271	14
β-strand	278-279	2	3
α-helix	281-290	10
α-helix	297-307	11
β-strand	315-316	2	3
α-helix	317-325	9
α-helix	326-328	3
α-helix	333-344	12
β-strand	351-352	2	4
α-helix	354-364	11
α-helix	370-380	11
β-strand	388-389	2	4
α-helix	390-397	8

Chain B: 16 helices, 18 β-strands

Element	Residues	Length	Sheet
α-helix	-34-1	36
α-helix	4-8	5
β-strand	11-22	12	5
β-strand	25-36	12	5
β-strand	41-48	8	5
α-helix	57-60	4
α-helix	69-71	3
β-strand	73	1	5
α-helix	76-81	6
α-helix	83-86	4
β-strand	92-100	9	5
β-strand	105-115	11	5
β-strand	118-128	11	5
β-strand	141	1	6
β-strand	148-155	8	5
α-helix	156-158	3
β-strand	160-170	11	5
β-strand	171	1	6
β-strand	176-187	12	5
α-helix	194-197	4
β-strand	199-208	10	5
β-strand	217-227	11	5
α-helix	258-271	14
β-strand	278-279	2	7
α-helix	281-290	10
α-helix	297-307	11
β-strand	315-316	2	7
α-helix	317-323	7
α-helix	333-344	12
β-strand	351-352	2	8
α-helix	354-364	11
α-helix	370-380	11
β-strand	388-389	2	8
α-helix	390-397	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Myosin light chain kinase 2, skeletal/cardiac muscle,Unconventional myosin-X,Green fluorescent…	A, B	protein	434	Oryctolagus cuniculus, Bos taurus, Aequorea victoria, Homo sapiens	P07313 (AlphaFold model), P0DP23 (AlphaFold model), P42212 (AlphaFold model), P79114 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6HR1_1 Myosin light chain kinase 2, skeletal/cardiac muscle,Unconventional myosin-X,Green fluorescent protein,Calmodulin-1 (chains A, B)
GPHMARWKKAFIAVSAANRFKKISSEEEKRKREEEEVSKGEELFTGVVPILVELDGDVNG
HKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFGYGLQCFARYPDHMKQHDFF
KSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYN
YNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSYQ
SALSKDPNEKRDHMVLLEFVTAAGITLGMDELYKGENLYFQSGGSAAAADQLTEEQIAEF
KEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMM
ARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDG
DGQVNYEEFVQMMTAK

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	8
TLA	L(+)-tartaric acid	C4 H6 O6	1

Water and common crystallization additives (NA, GOL, EDO) are not listed.

Primary citation

Chimeric single alpha-helical domains as rigid fusion protein connections for protein nanotechnology and structural biology. Collu, G., Bierig, T., Krebs, A.S. et al. Structure (2021). DOI 10.1016/j.str.2021.09.002 · PubMed

Other PDB entries of the same protein (UniProt P07313 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2BBM Solution structure of a calmodulin-target peptide complex by multidimensional NMR
2BBN Solution structure of a calmodulin-target peptide complex by multidimensional NMR

Browse structure collections

About this viewer

MolViewer shows 6HR1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.