6HUK: Human full-length alpha1beta3gamma2L GABA(A)R

CryoEM structure of human full-length alpha1beta3gamma2L GABA(A)R in complex with bicuculline and megabody Mb38. Determined by electron microscopy at 3.69 Å resolution. Released 2 Jan 2019.

Method: Electron microscopy
Resolution: 3.69 Å
Organisms: Bos taurus, Homo sapiens, Lama glama
Chains: 6
Atoms: 15,300
Mol. weight: 337.22 kDa
Ligands: H0Z, PIO
Released: 2 Jan 2019

Explore 6HUK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6HUK contains 69 α-helices and 101 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 23 β-strands

Element	Residues	Length	Sheet
α-helix	11-22	12
β-strand	39-49	11	1
β-strand	54	1	2
β-strand	59	1	2
β-strand	61-62	2	3
β-strand	63-70	8	1
β-strand	71	1	4
α-helix	73-75	3
β-strand	83	1	5
α-helix	88-91	4
β-strand	99-101	3	6
β-strand	108-109	2	7
β-strand	113	1	8
β-strand	120-121	2	9
β-strand	122	1	5
β-strand	126	1	4
β-strand	127-128	2	9
β-strand	129-132	4	1
β-strand	133-134	2	7
β-strand	135-136	2	3
β-strand	150-155	6	6
β-strand	157-159	3	6
β-strand	167-169	3	1
α-helix	175-178	4
β-strand	179-181	3	1
β-strand	191-204	14	6
β-strand	209-221	13	6
α-helix	224-226	3
α-helix	227-231	5
α-helix	232-243	12
α-helix	244-246	3
α-helix	252-275	24
α-helix	285-308	24
α-helix	316-318	3
α-helix	387-390	4
α-helix	391-415	25

Chain B: 12 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	10-19	10
α-helix	35	1
β-strand	36-51	16	10
β-strand	56-68	13	10
α-helix	70-72	3
β-strand	82-83	2	10
α-helix	85-87	3
β-strand	96-98	3	8
β-strand	101	1	11
β-strand	105-106	2	10
β-strand	116-118	3	10
β-strand	123-132	10	10
β-strand	134	1	11
β-strand	135	1	10
β-strand	151-156	6	8
β-strand	164-168	5	10
β-strand	176	1	10
β-strand	186-188	3	12
β-strand	192-199	8	8
β-strand	204-211	8	8
β-strand	214-216	3	12
α-helix	219-221	3
α-helix	222-226	5
α-helix	227-235	9
α-helix	236-241	6
α-helix	247-271	25
α-helix	280-303	24
α-helix	304-308	5
α-helix	420-445	26

Chain C: 14 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	27-35	9
α-helix	43	1
β-strand	51-66	16	13
β-strand	71-83	13	13
α-helix	85-87	3
β-strand	95-98	4	13
α-helix	103-105	3
β-strand	111-113	3	14
β-strand	116-121	6	13
β-strand	131-134	4	13
β-strand	138-150	13	13
β-strand	163-165	3	14
β-strand	168-171	4	14
β-strand	179-190	12	13
β-strand	201-214	14	14
β-strand	219-231	13	14
α-helix	237-241	5
α-helix	242-252	11
α-helix	253-256	4
α-helix	262-280	19
α-helix	282-284	3
α-helix	295-318	24
α-helix	319-323	5
α-helix	407-409	3
α-helix	410-430	21
α-helix	431-435	5

Chain D: 13 helices, 21 β-strands

Element	Residues	Length	Sheet
α-helix	10-20	11
β-strand	39-47	9	15
β-strand	53-54	2	15
β-strand	59-69	11	15
β-strand	71	1	16
α-helix	73-75	3
β-strand	83-85	3	17
α-helix	88-91	4
β-strand	99-101	3	18
β-strand	104	1	15
β-strand	108-109	2	15
β-strand	117	1	15
β-strand	120-122	3	17
β-strand	126	1	16
β-strand	127-128	2	17
β-strand	129-138	10	15
α-helix	143-145	3
β-strand	150-153	4	18
β-strand	157-159	3	18
β-strand	167-171	5	15
α-helix	175-178	4
β-strand	180-181	2	15
β-strand	191	1	19
β-strand	196-204	9	18
β-strand	209-220	12	18
β-strand	221	1	19
α-helix	224-226	3
α-helix	227-231	5
α-helix	232-243	12
α-helix	244-246	3
α-helix	252-274	23
α-helix	285-308	24
α-helix	387-390	4
α-helix	391-414	24

Chain E: 16 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	10-19	10
α-helix	27-28	2
α-helix	35	1
β-strand	36-51	16	20
β-strand	56-68	13	20
β-strand	82-83	2	20
α-helix	85-87	3
β-strand	96-98	3	21
β-strand	101	1	20
β-strand	105-106	2	20
β-strand	114-118	5	20
β-strand	123-135	13	20
α-helix	140-142	3
β-strand	147-148	2	22
β-strand	151-156	6	21
β-strand	164-168	5	20
α-helix	171-173	3
β-strand	176	1	20
β-strand	186-188	3	22
β-strand	193-198	6	21
α-helix	204	1
β-strand	205-211	7	21
β-strand	214-216	3	22
α-helix	217	1
α-helix	219-221	3
α-helix	222-226	5
α-helix	227-236	10
α-helix	237-241	5
α-helix	247-271	25
α-helix	280-303	24
α-helix	304-308	5
α-helix	421-445	25

Chain G: 1 helix, 12 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	23
β-strand	11-12	2	24
β-strand	423-431	9	23
β-strand	440-446	7	6
β-strand	450-457	8	6
β-strand	463-465	3	6
β-strand	474-478	5	23
β-strand	483-489	7	23
α-helix	493-495	3
β-strand	497-504	8	6
β-strand	516-519	4	6
β-strand	523-525	3	6
β-strand	526-527	2	24

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Gamma-aminobutyric acid receptor subunit alpha-1,Gamma-aminobutyric acid receptor subunit alpha-1	A, D	protein	464	Bos taurus, Homo sapiens	P08219 (AlphaFold model), P14867 (AlphaFold model)
Gamma-aminobutyric acid receptor subunit beta-3	B, E	protein	473	Homo sapiens	P28472 (AlphaFold model)
Gamma-aminobutyric acid receptor subunit gamma-2	C	protein	495	Homo sapiens	P18507 (AlphaFold model)
Megabody Mb38	G	protein	539	Lama glama

Sequence of entity 1 (A, D), FASTA

>6HUK_1 Gamma-aminobutyric acid receptor subunit alpha-1,Gamma-aminobutyric acid receptor subunit alpha-1 (chains A, D)
MKKSPGLSDYLWAWTLFLSTLTGRSYGDYKDDDDKQPSLQDELKDNTTVFTRILDRLLDG
YDNRLRPGLGERVTEVKTDIFVTSFGPVSDHDMEYTIDVFFRQSWKDERLKFKGPMTVLR
LNNLMASKIWTPDTFFHNGKKSVAHNMTMPNKLLRITEDGTLLYTMRLTVRAECPMHLED
FPMDAHACPLKFGSYAYTRAEVVYEWTREPARSVVVAEDGSRLNQYDLLGQTVDSGIVQS
STGEYVVMTTHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLT
MTTLSISARNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGYAWDGKSVVPE
KPKKVKDPLIKKNNTYAPTATSYTPNLARGDPGLATIAKSATIEPKEVKPETKPPEPKKT
FNSVSKIDRLSRIAFPLLFGIFNLVYWATYLNREPQLKAPTPHQ

Sequence of entity 2 (B, E), FASTA

>6HUK_2 Gamma-aminobutyric acid receptor subunit beta-3 (chains B, E)
MCSGLLELLLPIWLSWTLGTRGSEPRSVNDPGNMSFVKETVDKLLKGYDIRLRPDFGGPP
VCVGMNIDIASIDMVSEVNMDYTLTMYFQQYWRDKRLAYSGIPLNLTLDNRVADQLWVPD
TYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIE
SYGYTTDDIEFYWRGGDKAVTGVERIELPQFSIVEHRLVSRNVVFATGAYPRLSLSFRLK
RNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKI
PYVKAIDMYLMGCFVFVFLALLEYAFVNYIFFGRGPQRQKKLAEKTAKAKNDRSKSESNR
VDAHGNILLTSLEVHNEMNEVSGGIGDTRNSAISFDNSGIQYRKQSMPREGHGRFLGDRS
LPHKKTHLRRRSSQLKIKIPDLTDVNAIDRWSRIVFPFTFSLFNLVYWLYYVN

Sequence of entity 3 (C), FASTA

>6HUK_3 Gamma-aminobutyric acid receptor subunit gamma-2 (chains C)
MSSPNIWSTGSSVYSTPVFSQKMTVWILLLLSLYPGFTSQKSDDDYEDYASNKTWVLTPK
VPEGDVTVILNNLLEGYDNKLRPDIGVKPTLIHTDMYVNSIGPVNAINMEYTIDIFFAQT
WYDRRLKFNSTIKVLRLNSNMVGKIWIPDTFFRNSKKADAHWITTPNRMLRIWNDGRVLY
TLRLTIDAECQLQLHNFPMDEHSCPLEFSSYGYPREEIVYQWKRSSVEVGDTRSWRLYQF
SFVGLRNTTEVVKTTSGDYVVMSVYFDLSRRMGYFTIQTYIPCTLIVVLSWVSFWINKDA
VPARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFVSVCFIFVFSALVEYGTLHYFV
SNRKPSKDKDKKKKNPLLRMFSFKAPTIDIRPRSATIQMNNATHLQERDEEYGYECLDGK
DCASFFCCFEDCRTGAWRHGRIHIRIAKMDSYARIFFPTAFCLFNLVYWVSYLYLGGSGG
SGGSGKTETSQVAPA

Sequence of entity 4 (G), FASTA

>6HUK_4 Megabody Mb38 (chains G)
QVQLQESGGGLVQTKTTTSVIDTTNDAQNLLTQAQTIVNTLKDYCPILIAKSSSSNGGTN
NANTPSWQTAGGGKNSCATFGAEFSAASDMINNAQKIVQETQQLSANQPKNITQPHNLNL
NSPSSLTALAQKMLKNAQSQAEILKLANQVESDFNKLSSGHLKDYIGKCDASAISSANMT
MQNQKNNWGNGCAGVEETQSLLKTSAADFNNQTPQINQAQNLANTLIQELGNNPFRASGG
GSGGGGSGKLSDTYEQLSRLLTNDNGTNSKTSAQAINQAVNNLNERAKTLAGGTTNSPAY
QATLLALRSVLGLWNSMGYAVICGGYTKSPGENNQKDFHYTDENGNGTTINCGGSTNSNG
THSYNGTNTLKADKNVSLSIEQYEKIHEAYQILSKALKQAGLAPLNSKGEKLEAHVTTSK
YGSLRVSCAASGRTFTTYIMAWFRQAPGKEREFLAAMDQGRIQYYGDSVRGRFTISRDYA
KNSVDLQLDGLRPEDTAVYYCAAGAGFWGLRTASSYHYWGQGTQVTVSSHHHHHHEPEA

Ligands and cofactors

ID	Name	Formula	Copies
H0Z	bicuculline methochloride	C20 H17 N O6	2
PIO	[(2R)-2-octanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-d…	C25 H49 O19 P3	2

Primary citation

GABAAreceptor signalling mechanisms revealed by structural pharmacology. Masiulis, S., Desai, R., Uchanski, T. et al. Nature (2019) 565:454-459. DOI 10.1038/s41586-018-0832-5 · PubMed

Other PDB entries of the same protein (UniProt P08219 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6HUJ 3.04 Å, CryoEM structure of human full-length heteromeric alpha1beta3gamma2L GABA(A)R in complex…
6HUG 3.1 Å, CryoEM structure of human full-length alpha1beta3gamma2L GABA(A)R in complex with…
6HUO 3.26 Å, CryoEM structure of human full-length heteromeric alpha1beta3gamma2L GABA(A)R in complex…
6HUP 3.58 Å, CryoEM structure of human full-length alpha1beta3gamma2L GABA(A)R in complex with…

Browse structure collections

About this viewer

MolViewer shows 6HUK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.