6HYC: Full-length human phenylalanine hydroxylase

The structure of full-length human phenylalanine hydroxylase in complex with the cofactor and negative regulator tetrahydrobiopterin. Determined by X-ray diffraction at 3.18 Å resolution. Released 5 Jun 2019.

Method

X-ray diffraction

Resolution

3.18 Å

Organism

Homo sapiens

Chains

4

Atoms

13,879

Mol. weight

208.44 kDa

Ligands

H4B

Released

5 Jun 2019

Explore 6HYC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6HYC contains 98 α-helices and 68 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 24 helices, 16 β-strands

Molecules and chains

>6HYC_1 Phenylalanine-4-hydroxylase (chains A, B, C, D)
MSTAVLENPGLGRKLSDFGQETSYIEDNCNQNGAISLIFSLKEEVGALAKVLRLFEENDV
NLTHIESRPSRLKKDEYEFFTHLDKRSLPALTNIIKILRHDIGATVHELSRDKKKDTVPW
FPRTIQELDRFANQILSYGAELDADHPGFKDPVYRARRKQFADIAYNYRHGQPIPRVEYM
EEEKKTWGTVFKTLKSLYKTHACYEYNHIFPLLEKYCGFHEDNIPQLEDVSQFLQTCTGF
RLRPVAGLLSSRDFLGGLAFRVFHCTQYIRHGSKPMYTPEPDICHELLGHVPLFSDRSFA
QFSQEIGLASLGAPDEYIEKLATIYWFTVEFGLCKQGDSIKAYGAGLLSSFGELQYCLSE
KPKLLPLELEKTAIQNYTVTEFQPLYYVAESFNDAKEKVRNFAATIPRPFSVRYDPYTQR
IEVLDNTQQLKILADSINSEIGILCSALQKIK

Ligands and cofactors

Primary citation

Structure of full-length human phenylalanine hydroxylase in complex with tetrahydrobiopterin. Flydal, M.I., Alcorlo-Pages, M., Johannessen, F.G. et al. Proc Natl Acad Sci U S A (2019) 116:11229-11234. DOI 10.1073/pnas.1902639116 · PubMed

Related structures

Other PDB entries of the same protein (UniProt P00439 (AlphaFold model), which also has an AlphaFold model), best resolution first:

• 1J8U 1.5 Å, Catalytic Domain of Human Phenylalanine Hydroxylase Fe(II) in Complex with…
• 6HPO 1.67 Å, Crystallographic structure of the catalytic domain of Human Phenylalanine Hydroxylase…
• 1J8T 1.7 Å, Catalytic Domain of Human Phenylalanine Hydroxylase Fe(II)
• 5FII 1.8 Å, Structure of a human aspartate kinase, chorismate mutase and TyrA domain.
• 9T1O 1.94 Å, Crystal structure of phenylalanine hydroxylase (PAH) with Belinostat
• 1DMW 2.0 Å, Crystal structure of double truncated human phenylalanine hydroxylase with bound…
• 1MMK 2.0 Å, Crystal structure of ternary complex of the catalytic domain of human phenylalanine…
• 1MMT 2.0 Å, Crystal structure of ternary complex of the catalytic domain of human phenylalanine…
• 1PAH 2.0 Å, Human phenylalanine hydroxylase dimer, residues 117-424
• 3PAH 2.0 Å, Human phenylalanine hydroxylase catalytic domain dimer with bound adrenaline inhibitor
• 4PAH 2.0 Å, Human phenylalanine hydroxylase catalytic domain dimer with bound nor-adrenaline inhibitor
• 1LRM 2.1 Å, Crystal structure of binary complex of the catalytic domain of human phenylalanine…

Browse structure collections

About this viewer

MolViewer shows 6HYC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.