6I3F: Complex of human angiotensinogen and renin

Crystal structure of the complex of human angiotensinogen and renin at 2.55 Angstrom. Determined by X-ray diffraction at 2.55 Å resolution. Released 26 Dec 2018.

Method: X-ray diffraction
Resolution: 2.55 Å
Organism: Homo sapiens
Chains: 2
Atoms: 6,136
Mol. weight: 90.45 kDa
Released: 26 Dec 2018

Explore 6I3F in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6I3F contains 30 α-helices and 54 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 17 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	33-34	2	1
α-helix	36-37	2
β-strand	38	1	2
α-helix	44-46	3
α-helix	48-60	13
α-helix	64-91	28
β-strand	98-101	4	3
α-helix	103-115	13
α-helix	119-129	11
α-helix	144-159	16
β-strand	170-180	11	2
β-strand	186-187	2	1
α-helix	188-194	7
β-strand	201-205	5	2
α-helix	211-226	16
α-helix	234-236	3
β-strand	243-254	12	2
β-strand	258-260	3	3
β-strand	265-270	6	4
β-strand	273-277	5	4
β-strand	279-291	13	3
β-strand	296-302	7	3
β-strand	307-314	8	3
α-helix	317-319	3
α-helix	320-325	6
α-helix	328-330	3
α-helix	334-336	3
β-strand	340-349	10	3
β-strand	352-358	7	2
α-helix	359-365	7
β-strand	388-390	3	2
β-strand	392-400	9	2
β-strand	419-422	4	3
β-strand	427-433	7	3
α-helix	434-436	3
β-strand	438-445	8	3
α-helix	452-455	4

Chain B: 13 helices, 34 β-strands

Element	Residues	Length	Sheet
β-strand	6	1	5
β-strand	8-12	5	6
β-strand	13-15	3	7
β-strand	19-26	8	7
β-strand	31-38	8	7
β-strand	44-47	4	7
β-strand	48	1	8
α-helix	56-59	4
β-strand	64	1	8
α-helix	66-68	3
β-strand	73-82	10	7
β-strand	87-99	13	7
β-strand	102-113	12	7
α-helix	116-119	4
β-strand	126-129	4	7
α-helix	133-135	3
α-helix	137-139	3
α-helix	140-142	3
α-helix	143-150	8
β-strand	153	1	5
β-strand	157-162	6	6
β-strand	174-178	5	6
β-strand	186	1	9
β-strand	191-194	4	6
β-strand	202-205	4	10
β-strand	207-210	4	11
β-strand	216	1	11
β-strand	221-225	5	10
β-strand	232-234	3	10
α-helix	236-246	11
β-strand	249-251	3	12
β-strand	254-258	5	12
α-helix	262-264	3
α-helix	266-267	2
β-strand	268-271	4	11
β-strand	276-279	4	11
α-helix	281-284	4
β-strand	285	1	13
β-strand	295-297	3	12
β-strand	298	1	13
β-strand	300-302	3	10
α-helix	305-306	2
β-strand	313-315	3	10
α-helix	317-320	4
β-strand	323-328	6	6
β-strand	333-338	6	6
β-strand	339	1	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Angiotensinogen	A	protein	458	Homo sapiens	P01019 (AlphaFold model)
Renin	B	protein	340	Homo sapiens	P00797 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6I3F_1 Angiotensinogen (chains A)
DRVYIHPFHLVIHNESTCEQLAKANAGKPKDPTFIPAPIQAKTSPVDEKALQDQLVLVAA
KLDTEDKLRAAMVGMLANFLGFRIYGMHSELWGVVHGATVLSPTAVFGTLASLYLGALDH
TADRLQAILGVPWKDKQCTSRLDAHKVLSALQAVQGLLVAQGRADSQAQLLLSTVVGVFT
APGLHLKQPFVQGLALYTPVVLPRSLDFTELDVAAEKIDRFMQAVTGWKTGSSLMGASVD
STLAFNTYVHFQGKMKGFSLLAEPQEFWVDQSTSVSVPMLSGMGTFQHWSDIQDQFSVTQ
VPFTESASLLLIQPHYASDLDKVEGLTFQQNSLNWMKKLSPRTIHLTMPQLVLQGSYDLQ
DLLAQAELPAILHTELNLQKLSNDRIRVGEVLNSIFFELEADEREPTESTQQLNKPEVLE
VTLNRPFLFAVYDQSATALHFLGRVANPLSTAHHHHHH

Sequence of entity 2 (B), FASTA

>6I3F_2 Renin (chains B)
LTLGNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVY
HKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEMPALPFM
LAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYNRDSENSQSLGGQIVLGG
SDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVATGASYISGSTSSIE
KLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAI
HAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALAR

Primary citation

Structural basis for the specificity of renin-mediated angiotensinogen cleavage. Yan, Y., Zhou, A., Carrell, R.W. et al. J Biol Chem (2019) 294:2353-2364. DOI 10.1074/jbc.RA118.006608 · PubMed

Other PDB entries of the same protein (UniProt P01019 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5NJ9 1.25 Å, E. coli Microcin-processing metalloprotease TldD/E with DRVY angiotensin fragment bound
5NJA 1.4 Å, E. coli Microcin-processing metalloprotease TldD/E with angiotensin analogue bound
3WOO 1.8 Å, Crystal structure of the DAP BII hexapeptide complex I
4AA1 1.99 Å, Crystal structure of ANCE in complex with Angiotensin-II
4APH 1.99 Å, Human angiotensin-converting enzyme in complex with angiotensin-II
4FYS 2.01 Å, Human aminopeptidase N (CD13) in complex with angiotensin IV
3WOR 2.1 Å, Crystal structure of the DAP BII octapeptide complex
5M3Y 2.3 Å, Crystal structure of human glycosylated angiotensinogen
5E2Q 2.4 Å, Structure of human DPP3 in complex with angiotensin-II
5M3X 2.63 Å, Crystal structure of human angiotensin I-deleted angiotensinogen
6OS0 2.9 Å, Structure of synthetic nanobody-stabilized angiotensin II type 1 receptor bound to…
6I3I 2.97 Å, Crystal structure of reactive center loop (RCL) cleaved angiotensinogen

Browse structure collections

About this viewer

MolViewer shows 6I3F directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.