Crystal structure of reactive center loop (RCL) cleaved angiotensinogen. Determined by X-ray diffraction at 2.97 Å resolution. Released 26 Dec 2018.
Explore 6I3I in 3D Show helices and sheets RCSB PDB PDBe
6I3I contains 16 α-helices and 22 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 9-11 | 3 | |
| β-strand | 12 | 1 | 1 |
| β-strand | 33-34 | 2 | 2 |
| α-helix | 35-37 | 3 | |
| β-strand | 38 | 1 | 3 |
| α-helix | 44-46 | 3 | |
| α-helix | 48-59 | 12 | |
| α-helix | 64-86 | 23 | |
| α-helix | 91-93 | 3 | |
| β-strand | 96-97 | 2 | 3 |
| β-strand | 100-101 | 2 | 4 |
| α-helix | 103-115 | 13 | |
| α-helix | 119-129 | 11 | |
| β-strand | 142 | 1 | 1 |
| α-helix | 144-164 | 21 | |
| β-strand | 170-180 | 11 | 3 |
| β-strand | 186-187 | 2 | 2 |
| α-helix | 188-197 | 10 | |
| β-strand | 200-205 | 6 | 3 |
| α-helix | 211-226 | 16 | |
| β-strand | 243-254 | 12 | 3 |
| β-strand | 258-260 | 3 | 4 |
| β-strand | 265-267 | 3 | 5 |
| β-strand | 275-277 | 3 | 5 |
| β-strand | 279-291 | 13 | 4 |
| β-strand | 296-302 | 7 | 4 |
| β-strand | 307-314 | 8 | 4 |
| α-helix | 317-319 | 3 | |
| α-helix | 320-327 | 8 | |
| α-helix | 330-333 | 4 | |
| β-strand | 340-349 | 10 | 4 |
| β-strand | 352-358 | 7 | 3 |
| α-helix | 359-362 | 4 | |
| α-helix | 368-373 | 6 | |
| β-strand | 388-400 | 13 | 3 |
| β-strand | 419-422 | 4 | 4 |
| β-strand | 427-433 | 7 | 4 |
| β-strand | 438-445 | 8 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Angiotensinogen | A | protein | 458 | Homo sapiens | P01019 (AlphaFold model) |
>6I3I_1 Angiotensinogen (chains A) DRVYIHPFHLVIHNESTCEQLAKANAGKPKDPTFIPAPIQAKTSPVDEKALQDQLVLVAA KLDTEDKLRAAMVGMLANFLGFRIYGMHSELWGVVHGATVLSPTAVFGTLASLYLGALDH TADRLQAILGVPWKDKQCTSRLDAHKVLSALQAVQGLLVAQGRADSQAQLLLSTVVGVFT APGLHLKQPFVQGLALYTPVVLPRSLDFTELDVAAEKIDRFMQAVTGWKTGSSLMGASVD STLAFNTYVHFQGKMKGFSLLAEPQEFWVDQSTSVSVPMLSGMGTFQHWSDIQDQFSVTQ VPFTESASLLLIQPHYASDLDKVEGLTFQQNSLNWMKKLSPRTIHLTMPQLVLQGSYDLQ DLLAQAELPAILHTELNLQKLSNDRIRVGEVLNSIFFELEADEREPTESTQQLNKPEVLE VTLNRPFLFAVYDQSATALHFLGRVANPLSTAHHHHHH
| ID | Name | Formula | Copies |
|---|---|---|---|
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 1 |
Structural basis for the specificity of renin-mediated angiotensinogen cleavage. Yan, Y., Zhou, A., Carrell, R.W. et al. J Biol Chem (2019) 294:2353-2364. DOI 10.1074/jbc.RA118.006608 · PubMed
Other PDB entries of the same protein (UniProt P01019 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6I3I directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.