6I9K: Jumping Spider Rhodopsin-1

Crystal structure of Jumping Spider Rhodopsin-1 bound to 9-cis retinal. Determined by X-ray diffraction at 2.15 Å resolution. Released 3 Jul 2019.

Method: X-ray diffraction
Resolution: 2.15 Å
Organism: Hasarius adansoni
Chains: 1
Atoms: 2,616
Mol. weight: 46.8 kDa
Ligands: RET, OLC
Released: 3 Jul 2019

Explore 6I9K in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6I9K contains 17 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 17 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	23-26	4
α-helix	29-34	6
α-helix	37-41	5
α-helix	43-46	4
α-helix	47-75	29
α-helix	79-81	3
α-helix	84-113	30
α-helix	120-152	33
α-helix	163-182	20
α-helix	183-185	3
β-strand	191-193	3	1
β-strand	200-202	3	1
α-helix	209-219	11
α-helix	220-224	5
α-helix	225-252	28
α-helix	264-302	39
α-helix	310-321	12
α-helix	322-325	4
α-helix	326-333	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Kumopsin1	A	protein	380	Hasarius adansoni	B1B1U5 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6I9K_1 Kumopsin1 (chains A)
MLPHAAKMAARVAGDHDGRNISIVDLLPEDMLPMIHEHWYKFPPMETSMHYILGMLIIVI
GIISVSGNGVVMYLMMTVKNLRTPGNFLVLNLALSDFGMLFFMMPTMSINCFAETWVIGP
FMCELYGMIGSLFGSASIWSLVMITLDRYNVIVKGMAGKPLTKVGALLRMLFVWIWSLGW
TIAPMYGWSRYVPEGSMTSCTIDYIDTAINPMSYLIAYAIFVYFVPLFIIIYCYAFIVMQ
VAAHEKSLREQAKKMNIKSLRSNEDNKKASAEFRLAKVAFMTICCWFMAWTPYLTLSFLG
IFSDRTWLTPMTSVWGAIFAKASACYNPIVYGISHPKYRAALHDKFPCLKCGSDSPKGDS
ASTVAESEKAGEETSQVAPA

Ligands and cofactors

ID	Name	Formula	Copies
RET	Retinal	C20 H28 O	1
OLC	(2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate	C21 H40 O4	11

Primary citation

Crystal structure of jumping spider rhodopsin-1 as a light sensitive GPCR. Varma, N., Mutt, E., Muhle, J. et al. Proc Natl Acad Sci U S A (2019) 116:14547-14556. DOI 10.1073/pnas.1902192116 · PubMed

Other PDB entries of the same protein (UniProt B1B1U5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9EPP 4.06 Å, Cryo-EM Structure of Jumping Spider Rhodopsin-1 bound to a Giq heterotrimer
9EPQ 4.15 Å, Cryo-EM Structure of Jumping Spider Rhodopsin-1 bound to a Giq heterotrimer
9EPR 4.9 Å, Cryo-EM Structure of Jumping Spider Rhodopsin-1 bound to a Gi heterotrimer

Browse structure collections

About this viewer

MolViewer shows 6I9K directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.