Alpha-1-antitrypsin Queen's (Lys154Asn) variant. Determined by X-ray diffraction at 1.9 Å resolution. Released 18 Dec 2019.
Explore 6IAY in 3D Show helices and sheets RCSB PDB PDBe
6IAY contains 15 α-helices and 19 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 27-44 | 18 | |
| β-strand | 50-52 | 3 | 1 |
| α-helix | 54-65 | 12 | |
| α-helix | 70-79 | 10 | |
| α-helix | 89-103 | 15 | |
| β-strand | 112-121 | 10 | 2 |
| β-strand | 126 | 1 | 3 |
| α-helix | 128-132 | 5 | |
| α-helix | 133-137 | 5 | |
| β-strand | 141-145 | 5 | 2 |
| α-helix | 150-164 | 15 | |
| β-strand | 182-191 | 10 | 2 |
| β-strand | 194 | 1 | 4 |
| α-helix | 197-199 | 3 | |
| α-helix | 200-202 | 3 | |
| β-strand | 204-211 | 8 | 5 |
| β-strand | 214-227 | 14 | 5 |
| β-strand | 228-232 | 5 | 1 |
| β-strand | 237-243 | 7 | 1 |
| β-strand | 244 | 1 | 4 |
| β-strand | 248-255 | 8 | 1 |
| α-helix | 256 | 1 | |
| α-helix | 260-266 | 7 | |
| α-helix | 269-277 | 9 | |
| β-strand | 282-289 | 8 | 5 |
| β-strand | 291-298 | 8 | 2 |
| α-helix | 299-305 | 7 | |
| α-helix | 310-312 | 3 | |
| β-strand | 322 | 1 | 3 |
| β-strand | 331-340 | 10 | 2 |
| α-helix | 360-362 | 3 | |
| β-strand | 363-365 | 3 | 5 |
| β-strand | 370-376 | 7 | 1 |
| β-strand | 382-388 | 7 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Alpha-1-antitrypsin | A | protein | 404 | Homo sapiens | P01009 (AlphaFold model) |
>6IAY_1 Alpha-1-antitrypsin (chains A) MRGSHHHHHHTDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNI FFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQL QLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEANKQINDYVEKGTQGKIV DLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQ HSKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPK LSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGA MFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK
| ID | Name | Formula | Copies |
|---|---|---|---|
| GLY | Glycine | C2 H5 N O2 | 1 |
Structural determinants of instability in alpha-1-antitrypsin. Aldobiyan, I., Irving, J.A., Lomas, D.A. To be published.
Other PDB entries of the same protein (UniProt P01009 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6IAY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.