6ICS: Loop deletion mutant

Loop deletion mutant (deleting four residues). Determined by X-ray diffraction at 1.4 Å resolution. Released 3 Jul 2019.

Method: X-ray diffraction
Resolution: 1.4 Å
Organism: Borrelia burgdorferi
Chains: 1
Atoms: 2,164
Mol. weight: 26.08 kDa
Released: 3 Jul 2019

Explore 6ICS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6ICS contains 2 α-helices and 23 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain O: 2 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	29-34	6	1
β-strand	38-43	6	1
β-strand	52-58	7	1
β-strand	61-67	7	1
β-strand	74-79	6	1
β-strand	85-90	6	1
β-strand	97-102	6	1
β-strand	109-115	7	1
β-strand	121-126	6	1
β-strand	132-138	7	1
β-strand	144-148	5	1
β-strand	156-162	7	1
β-strand	165-171	7	1
β-strand	175-182	8	1
β-strand	185-192	8	1
β-strand	197-203	7	1
β-strand	208-213	6	2
β-strand	218-223	6	2
β-strand	226-233	8	2
β-strand	239-243	5	2
β-strand	244	1	3
α-helix	245	1
β-strand	251	1	3
β-strand	256-257	2	2
α-helix	261-267	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Outer surface protein A	O	protein	247	Borrelia burgdorferi	P0CL66 (AlphaFold model)

Sequence of entity 1 (O), FASTA

>6ICS_1 Outer surface protein A (chains O)
GSHMKNSVSVDLPGSMKVLVSKSSNADGKYDLIATVDALELSGTSDKNNGSGVLEGVKAD
ASKVKLTISDDLGQTTLEVFKSDGSTLVSKKVTSKDKSSTEEKFNEKGEVSEKIITRADG
TRLEYTGIKSDGSGKAKEVLKGYVLEGTLTAEKTTLVVKEGTVTLSKNISKSGAVSVELN
DTDTKKTAAWNSGTSTLTITVNSKKTKDLVFTSSNTITVQQYDSNGTSLEGSAVEITKLD
EIKNALK

Primary citation

Domain-Swapping Design by Polyproline Rod Insertion. Shiga, S., Yamanaka, M., Fujiwara, W. et al. Chembiochem (2019) 20:2454-2457. DOI 10.1002/cbic.201900179 · PubMed

Other PDB entries of the same protein (UniProt P0CL66 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2I5V 1.1 Å, Crystal structure of OspA mutant
2G8C 1.15 Å, Atomic-resolution crystal structure of Borrelia burgdorferi OspA via surface entropy…
2I5Z 1.2 Å, The crystal structure of OspA mutant
6J48 1.2 Å, Glycine mutation on single layer beta-sheet of OspAsm1
9WVV 1.27 Å, The crystal structure of OspA mutant
2OYB 1.3 Å, The crystal structure of OspA mutant
2OL7 1.35 Å, The crystal structure of OspA mutant
6KWV 1.37 Å, A Crystal Structure of OspA mutant
2PI3 1.4 Å, The crystal structure of OspA mutant
6KT1 1.43 Å, Crystal structure of an OspA mutant
6KWU 1.43 Å, A Crystal Structure of OspA mutant
6J6E 1.5 Å, Borrelia burgdorferi OspA via surface entropy reduction (form5)

Browse structure collections

About this viewer

MolViewer shows 6ICS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.