6IEU: Tripartite motif-containing protein 66

The structure of TRIM66 PHD-Bromo domain with unmodified H3 N terminal peptide. Determined by X-ray diffraction at 1.79 Å resolution. Released 18 Sept 2019.

Method: X-ray diffraction
Resolution: 1.79 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,547
Mol. weight: 24.23 kDa
Ligands: ZN
Released: 18 Sept 2019

Explore 6IEU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6IEU contains 11 α-helices and 3 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	981-984	4	1
α-helix	985	1
β-strand	991-992	2	1
α-helix	1004-1005	2
α-helix	1012-1014	3
α-helix	1044-1059	16
α-helix	1061-1066	6
α-helix	1069-1071	3
α-helix	1077-1080	4
α-helix	1087-1093	7
α-helix	1105-1122	18
α-helix	1128-1147	20

Chain C: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
β-strand	3-5	3	1
α-helix	7-9	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tripartite motif-containing protein 66	A	protein	196	Homo sapiens	O15016 (AlphaFold model)
Ala-arg-thr-lys-gln-thr-ala-arg-lys-ser-thr-gly	C	protein	12	Homo sapiens	P68431 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6IEU_1 Tripartite motif-containing protein 66 (chains A)
PHMENEDFCAVCLNGGELLCCDRCPKVFHLSCHVPALTSFPGGEWVCTLCRSLTQPEMEY
DSENASHNQPGKRASPGLSMYDQKKCEKLVLSLCCNNLSLPFHEPVSPLARHYYQIIKRP
MDLSTIRRKLQKKDPAHYTTPEEVVSDVRLMFWNCAKFNYPDSEVAEAGRSLENFFEGWL
KEIYPEKRFAQPRQED

Sequence of entity 2 (C), FASTA

>6IEU_2 ALA-ARG-THR-LYS-GLN-THR-ALA-ARG-LYS-SER-THR-GLY (chains C)
ARTKQTARKSTG

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Water and common crystallization additives (GOL) are not listed.

Primary citation

TRIM66 reads unmodified H3R2K4 and H3K56ac to respond to DNA damage in embryonic stem cells. Chen, J., Wang, Z., Guo, X. et al. Nat Commun (2019) 10:4273-4273. DOI 10.1038/s41467-019-12126-4 · PubMed

Other PDB entries of the same protein (UniProt O15016 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8JZW 1.8 Å, Cystal structure of HP1 in complex with TRIM66 peptide
6IET 2.1 Å, The crystal structure of TRIM66 PHD-Bromo domain

Browse structure collections

About this viewer

MolViewer shows 6IEU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.