6IGT: MPZL1 mutant - V145G, Q146K, P147T and G148S

MPZL1 mutant - V145G, Q146K, P147T and G148S. Determined by X-ray diffraction at 2.4 Å resolution. Released 28 Nov 2018.

Method: X-ray diffraction
Resolution: 2.4 Å
Organism: Homo sapiens
Chains: 4
Atoms: 3,690
Mol. weight: 60.85 kDa
Released: 28 Nov 2018

Explore 6IGT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6IGT contains 9 α-helices and 52 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	39-41	3	1
β-strand	45-49	5	2
β-strand	54-56	3	3
β-strand	59-61	3	1
β-strand	71-78	8	2
β-strand	85-91	7	2
β-strand	94-97	4	2
α-helix	101-103	3
β-strand	107-109	3	3
β-strand	112	1	1
α-helix	113-115	3
β-strand	117	1	1
β-strand	120-122	3	3
α-helix	127-129	3
β-strand	131-138	8	2
β-strand	145-155	11	2

Chains B and C: 2 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	39-41	3	4
β-strand	45-49	5	5
β-strand	54-56	3	6
β-strand	59-61	3	4
β-strand	71-78	8	5
β-strand	85-91	7	5
β-strand	94-97	4	5
α-helix	101-103	3
β-strand	107-109	3	6
β-strand	112	1	4
β-strand	117	1	4
β-strand	120-122	3	6
α-helix	127-129	3
β-strand	131-138	8	5
β-strand	146-155	10	5

Chain D: 2 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	39-41	3	9
β-strand	45-49	5	2
β-strand	54-56	3	10
β-strand	59-61	3	9
β-strand	71-78	8	2
β-strand	85-91	7	2
β-strand	94-97	4	2
α-helix	101-103	3
β-strand	107-109	3	10
β-strand	112	1	9
β-strand	117	1	9
β-strand	120-122	3	10
α-helix	127-129	3
β-strand	131-138	8	2
β-strand	145-155	11	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Myelin protein zero-like protein 1	A, B, C, D	protein	135	Homo sapiens	O95297 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>6IGT_1 Myelin protein zero-like protein 1 (chains A, B, C, D)
SALEVYTPKEIFVANGTQGKLTCKFKSTSTTGGLTSVSWSFQPEGADTTVSFFHYSQGQV
YLGNYPPFKDRISWAGDLDKKDASINIENMQFIHNGTYICDVKNPPDIVGKTSHIRLYVV
EKENLPVLEHHHHHH

Primary citation

Structural and biochemical studies of the extracellular domain of Myelin protein zero-like protein 1. Yu, T., Liang, L., Zhao, X. et al. Biochem Biophys Res Commun (2018) 506:883-890. DOI 10.1016/j.bbrc.2018.10.161 · PubMed

Other PDB entries of the same protein (UniProt O95297 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9MQ5 1.7 Å, Crystal structure SHP2 tandem SH2 domains in complex with PZR doubly tyrosine…
6IGW 1.98 Å, MPZL1 mutant - S86G, V145G, Q146K,P147T,G148S
6IGO 2.75 Å, Crystal structure of myelin protein zero-like protein 1 (MPZL1)

Browse structure collections

About this viewer

MolViewer shows 6IGT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.