Crystal structure of Arabidopsis thaliana JMJ13 catalytic domain in complex with AKG. Determined by X-ray diffraction at 2.4 Å resolution. Released 10 Apr 2019.
Explore 6IP0 in 3D Show helices and sheets RCSB PDB PDBe
6IP0 contains 25 α-helices and 24 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 96-99 | 4 | |
| α-helix | 101 | 1 | |
| β-strand | 102 | 1 | 1 |
| α-helix | 103-104 | 2 | |
| β-strand | 105-106 | 2 | 2 |
| α-helix | 110-113 | 4 | |
| α-helix | 116-127 | 12 | |
| β-strand | 132-136 | 5 | 2 |
| α-helix | 145-151 | 7 | |
| β-strand | 158-159 | 2 | 3 |
| β-strand | 161-164 | 4 | 4 |
| α-helix | 167-169 | 3 | |
| α-helix | 172-180 | 9 | |
| β-strand | 184-185 | 2 | 3 |
| α-helix | 187-202 | 16 | |
| α-helix | 210-223 | 14 | |
| β-strand | 228-231 | 4 | 4 |
| β-strand | 232-235 | 4 | 2 |
| α-helix | 255-260 | 6 | |
| α-helix | 265-268 | 4 | |
| β-strand | 274 | 1 | 5 |
| β-strand | 278 | 1 | 5 |
| β-strand | 280-284 | 5 | 2 |
| β-strand | 289-293 | 5 | 1 |
| α-helix | 296-298 | 3 | |
| β-strand | 300-308 | 9 | 2 |
| β-strand | 311-315 | 5 | 1 |
| α-helix | 318-320 | 3 | |
| α-helix | 321-333 | 13 | |
| α-helix | 347-351 | 5 | |
| α-helix | 355-356 | 2 | |
| α-helix | 359-363 | 5 | |
| β-strand | 370-374 | 5 | 1 |
| β-strand | 378-382 | 5 | 2 |
| β-strand | 388-392 | 5 | 1 |
| β-strand | 396-403 | 8 | 2 |
| α-helix | 406-408 | 3 | |
| α-helix | 409-421 | 13 | |
| α-helix | 430-443 | 14 | |
| α-helix | 447-451 | 5 | |
| α-helix | 454-484 | 31 | |
| β-strand | 489-493 | 5 | 6 |
| β-strand | 498-499 | 2 | 7 |
| β-strand | 506-507 | 2 | 7 |
| β-strand | 510-513 | 4 | 6 |
| β-strand | 521 | 1 | 6 |
| α-helix | 527-529 | 3 | |
| β-strand | 539-543 | 5 | 6 |
| α-helix | 546-557 | 12 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Transcription factor jumonji (Jmj) family protein | A | protein | 490 | Arabidopsis thaliana | F4KIX0 (AlphaFold model) |
>6IP0_1 Transcription factor jumonji (Jmj) family protein (chains A) SETDDLKWTERLPECPVYRPTKEEFEDPLTYLQKIFPEASKYGICKIVSPLTATVPAGAV LMKEKSNFKFTTRVQPLRLAEWDSDDKVTFFMSGRTYTFRDYEKMANKVFARRYCSGGSL PDSFLEKEFWKEIACGKTETVEYACDVDGSAFSSAPGDPLGSSKWNLNKVSRLPKSTLRL LETSIPGVTEPMLYIGMLFSMFAWHVEDHYLYSINYQHCGASKTWYGIPGSAALKFEKVV KECVYNDDILSTNGEDGAFDVLLGKTTIFPPKTLLDHNVPVYKAVQKPGEFVVTFPRAYH AGFSHGFNCGEAVNFAMGDWFPFGAIASCRYAHLNRVPLLPHEELICKEAMLLNSSSKSE NLDLTPTELSGQRSIKTAFVHLIRFLHLARWSLMKSGLCTGLVSNTYGTIVCSLCKRDCY LAFINCECYSHPVCLRHDVKKLDLPCGTTHTLYLRDNIEDMEAAAMKFEKEDGVSDLITT DEDLYKYPSS
Water and common crystallization additives (SO4) are not listed.
The Arabidopsis H3K27me3 demethylase JUMONJI 13 is a temperature and photoperiod dependent flowering repressor. Zheng, S., Hu, H., Ren, H. et al. Nat Commun (2019) 10:1303-1303. DOI 10.1038/s41467-019-09310-x · PubMed
Other PDB entries of the same protein (UniProt F4KIX0 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6IP0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.