6IRE: Complex structure of INAD PDZ45 and NORPA CC-PBM

Complex structure of INAD PDZ45 and NORPA CC-PBM. Determined by X-ray diffraction at 3.25 Å resolution. Released 23 Jan 2019.

Method: X-ray diffraction
Resolution: 3.25 Å
Organism: Drosophila melanogaster
Chains: 2
Atoms: 2,982
Mol. weight: 48.39 kDa
Released: 23 Jan 2019

Explore 6IRE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6IRE contains 14 α-helices and 13 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	865-866	2
α-helix	868-870	3
α-helix	873-877	5
α-helix	883-915	33
α-helix	934-1013	80
α-helix	1024-1086	63
α-helix	1089-1091	3
β-strand	1093-1094	2	1

Chain B: 7 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	486-493	8	2
β-strand	501-504	4	2
β-strand	516-520	5	2
α-helix	525-529	5
β-strand	536-541	6	2
β-strand	545	1	2
α-helix	553-560	8
β-strand	567-574	8	2
α-helix	578-579	2
β-strand	581-588	8	1
β-strand	597-601	5	1
β-strand	606-611	6	1
α-helix	617-620	4
α-helix	627	1
β-strand	628-632	5	1
β-strand	635-636	2	1
α-helix	642-651	10
β-strand	655-662	8	1
α-helix	665-667	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase	A	protein	234	Drosophila melanogaster	P13217 (AlphaFold model)
Inactivation-no-after-potential D protein	B	protein	194	Drosophila melanogaster	Q24008 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6IRE_1 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase (chains A)
AEPPLVFEPVTLESLRQEAGFQAVGAAQIAELDTLRAAHAAERTSVQKTQNAAIDKLIKG
KSKDDIRNDANIKNSINDQTKQWTDMIARHRKEEWDMLRQHVQDSQDAMKALMLTVQAAQ
IKQLEDRHARDIKDLNAKQAKMSADTAKEVQNDKTLKTKNEKDRRLREKRQNNVKRFMEE
KKQIGVKQGRAMEKLKLAHSKQIEEFSTDVQKLMDMYKIEEEAYKTQGKTEFYA

Sequence of entity 2 (B), FASTA

>6IRE_2 Inactivation-no-after-potential D protein (chains B)
ATAEIKPNKKILIELKVEKKPMGVIVCGGKNNHVTTGCVITHVYPEGQVAADKRLKIFDH
ICDINGTPIHVGSMTTLKVHQLFHTTYEKAVTLTVFRADPPELEKFNVDLMKKAGKELGL
SLSPNEIGCTIADLIQGQYPEIDSKLQRGDIITKFNGDALEGLPFQVCYALFKGANGKVS
MEVTRPKPTLRTEA

Primary citation

An unexpected INAD PDZ tandem-mediated plc beta binding in Drosophila photo receptors. Ye, F., Huang, Y., Li, J. et al. Elife (2018) 7. DOI 10.7554/eLife.41848 · PubMed

Other PDB entries of the same protein (UniProt P13217 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6IRB 2.66 Å, C-terminal coiled coil domain of Drosophila phospholipase C beta NORPA, selenomethionine
6IRC 3.54 Å, C-terminal domain of Drosophila phospholipase b NORPA, methylated

Browse structure collections

About this viewer

MolViewer shows 6IRE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.