6IWV: Single strand DNA binding protein

Name: PDB 6IWV: Crystal structure of a single strand DNA binding protein
Published: 2019-08-14
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: dna binding protein

Crystal structure of a single strand DNA binding protein. Determined by X-ray diffraction at 1.52 Å resolution. Released 14 Aug 2019.

Method: X-ray diffraction
Resolution: 1.52 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,201
Mol. weight: 15.71 kDa
Released: 14 Aug 2019

Explore 6IWV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6IWV contains 7 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	16-32	17
α-helix	36-45	10
α-helix	59	1
α-helix	60-73	14

Chain B: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	15-32	18
α-helix	36-45	10
α-helix	60-72	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Single-stranded DNA-binding protein 2	A, B	protein	68	Homo sapiens	P81877 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6IWV_1 Single-stranded DNA-binding protein 2 (chains A, B)
SAVPSDSQAREKLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWCVFW
DLYCAAPE

Primary citation

Crystal structure of the LUFS domain of human single-stranded DNA binding Protein 2 (SSBP2). Wang, H., Wang, Z., Tang, Q. et al. Protein Sci (2019) 28:788-793. DOI 10.1002/pro.3581 · PubMed

Other PDB entries of the same protein (UniProt P81877 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8HIB 2.45 Å, The crystal structure of Pygo2-LDB1-SSBP2 triple complex
6TYD 2.8 Å, Structure of human LDB1 in complex with SSBP2

Browse structure collections

About this viewer

MolViewer shows 6IWV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.