6JFV: 2B-2B complex from keratins 5 and 14

The crystal structure of 2B-2B complex from keratins 5 and 14 (C367A mutant of K14). Determined by X-ray diffraction at 2.6 Å resolution. Released 22 Jan 2020.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: Homo sapiens
Chains: 4
Atoms: 3,087
Mol. weight: 45.06 kDa
Released: 22 Jan 2020

Explore 6JFV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6JFV contains 4 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	329-417	89

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	384-474	91

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	331-418	88

Chain D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	385-475	91

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Keratin, type I cytoskeletal 14	A, C	protein	95	Homo sapiens	P02533 (AlphaFold model)
Keratin, type II cytoskeletal 5	B, D	protein	98	Homo sapiens	P13647 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>6JFV_1 Keratin, type I cytoskeletal 14 (chains A, C)
GKSEISELRRTMQNLEIELQSQLSMKASLENSLEETKGRYAMQLAQIQEMIGSVEEQLAQ
LRCEMEQQNQEYKILLDVKTRLEQEIATYRRLLEG

Sequence of entity 2 (B, D), FASTA

>6JFV_2 Keratin, type II cytoskeletal 5 (chains B, D)
LRNTKHEISEMNRMIQRLRAEIDNVKKQCANLQNAIADAEQRGELALKDARNKLAELEEA
LQKAKQDMARLLREYQELMNTKLALDVEIATYRKLLEG

Primary citation

Structure-Function Analyses of a Keratin Heterotypic Complex Identify Specific Keratin Regions Involved in Intermediate Filament Assembly. Lee, C.H., Kim, M.S., Li, S. et al. Structure (2020) 28:355-362.e4. DOI 10.1016/j.str.2020.01.002 · PubMed

Other PDB entries of the same protein (UniProt P02533 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3TNU 3.0 Å, Heterocomplex of coil 2B domains of human intermediate filament proteins, keratin 5…
9VHF Keratin 14 120 - 144 peptide fragment (R125G)
9VHO Keratin 14 120 - 144 peptide fragment (R125H)
9VHS Keratin 14 120 - 144 peptide fragment
9VHX Keratin 14 120 - 144 peptide fragment (R125S)

Browse structure collections

About this viewer

MolViewer shows 6JFV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.