6JO7: Mouse MXRA8

Crystal structure of mouse MXRA8. Determined by X-ray diffraction at 2.4 Å resolution. Released 15 May 2019.

Method: X-ray diffraction
Resolution: 2.4 Å
Organism: Mus musculus
Chains: 2
Atoms: 4,105
Mol. weight: 61.45 kDa
Released: 15 May 2019

Explore 6JO7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6JO7 contains 19 α-helices and 46 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	12-21	10	1
α-helix	26	1
β-strand	27-29	3	2
β-strand	32	1	3
α-helix	34-36	3
β-strand	48-54	7	4
β-strand	63-69	7	4
β-strand	72-76	5	4
α-helix	79-81	3
β-strand	85-87	3	5
α-helix	91-94	4
β-strand	96	1	6
β-strand	99-101	3	5
α-helix	106-108	3
β-strand	110-118	9	4
β-strand	123-134	12	4
α-helix	137-139	3
β-strand	141-143	3	4
β-strand	149-154	6	4
β-strand	159-161	3	5
β-strand	164	1	6
α-helix	168-171	4
β-strand	181-187	7	1
α-helix	196	1
β-strand	197-203	7	1
β-strand	208-210	3	1
α-helix	214-217	4
β-strand	220-221	2	2
α-helix	224-229	6
β-strand	231	1	3
β-strand	234-236	3	2
α-helix	241-243	3
β-strand	245-253	9	1
β-strand	258-268	11	1

Chain B: 8 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	12-21	10	7
β-strand	27-29	3	8
β-strand	32	1	9
α-helix	34-36	3
β-strand	48-55	8	10
β-strand	62-69	8	10
β-strand	75-76	2	10
α-helix	79-81	3
β-strand	85-87	3	11
α-helix	91-94	4
β-strand	96	1	12
β-strand	99-101	3	11
α-helix	106-108	3
β-strand	110-118	9	10
β-strand	124-134	11	10
α-helix	137-139	3
β-strand	141-143	3	10
β-strand	149-154	6	10
β-strand	159-161	3	11
β-strand	164	1	12
β-strand	181-187	7	7
β-strand	197-203	7	7
β-strand	208-210	3	7
α-helix	214-217	4
β-strand	220-221	2	8
α-helix	226-229	4
β-strand	231	1	9
β-strand	234-236	3	8
α-helix	241-243	3
β-strand	245-253	9	7
β-strand	258-268	11	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Matrix remodeling-associated protein 8	A, B	protein	270	Mus musculus	Q9DBV4 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6JO7_1 Matrix remodeling-associated protein 8 (chains A, B)
MSGPSGTAAASSSLVSESVVSLAAGTQAVLRCQSPRMVWTQDRLHDRQRVVHWDLSGGPG
SQRRRLVDMYSAGEQRVYEPRDRDRLLLSPSAFHDGNFSLLIRAVDRGDEGVYTCNLHHH
YCHLDESLAVRLEVTEDPLLSRAYWDGEKEVLVVAHGAPALMTCINRAHVWTDRHLEEAQ
QVVHWDRQLPGVSHDRADRLLDLYASGERRAYGPPFLRDRVSVNTNAFARGDFSLRIDEL
ERADEGIYSCHLHHHYCGLHERRVFHLQVT

Primary citation

Molecular Basis of Arthritogenic Alphavirus Receptor MXRA8 Binding to Chikungunya Virus Envelope Protein. Song, H., Zhao, Z., Chai, Y. et al. Cell (2019) 177:1714-1724.e12. DOI 10.1016/j.cell.2019.04.008 · PubMed

Other PDB entries of the same protein (UniProt Q9DBV4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6NK3 2.2 Å, Crystal structure of murine Mxra8 ectodomain
8SQN 3.89 Å, CryoEM structure of Western equine encephalitis virus VLP in complex with the chimeric…
8EWF 3.92 Å, CryoEM structure of Western equine encephalitis virus VLP in complex with the avian…
6NK6 4.06 Å, Electron Cryo-Microscopy Of Chikungunya VLP in complex with mouse Mxra8 receptor
6NK7 4.99 Å, Electron Cryo-Microscopy of Chikungunya in Complex with Mouse Mxra8 Receptor

Browse structure collections

About this viewer

MolViewer shows 6JO7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.