6JOD: Angiotensin II type 2 receptor with ligand

Angiotensin II type 2 receptor with ligand. Determined by X-ray diffraction at 3.2 Å resolution. Released 15 Jan 2020.

Method: X-ray diffraction
Resolution: 3.2 Å
Organisms: Homo sapiens, Escherichia coli, Mus musculus
Chains: 5
Atoms: 6,257
Mol. weight: 92.57 kDa
Released: 15 Jan 2020

Explore 6JOD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6JOD contains 31 α-helices and 44 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	42-45	4
α-helix	47-70	24
α-helix	78-94	17
α-helix	97-105	9
α-helix	114-147	34
α-helix	157-174	18
α-helix	176-181	6
β-strand	182-187	6	1
β-strand	192-197	6	1
α-helix	201-203	3
α-helix	204-216	13
α-helix	217-221	5
α-helix	222-241	20
α-helix	246-284	39
α-helix	290-318	29
α-helix	323-333	11
α-helix	335-339	5

Chain C: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	1009-1018	10
α-helix	1023-1038	16
α-helix	1068-1081	14
α-helix	1084-1092	9

Chain H: 2 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	2
β-strand	10-12	3	3
β-strand	17-25	9	2
β-strand	34-39	6	3
β-strand	45-51	7	3
β-strand	58-60	3	3
β-strand	68-73	6	2
β-strand	78-84	7	2
α-helix	88-90	3
β-strand	92-98	7	3
β-strand	109-110	2	3
β-strand	114-118	5	3
β-strand	124	1	4
α-helix	125-126	2
β-strand	127-131	5	5
β-strand	142-152	11	5
β-strand	153	1	4
β-strand	158-163	6	6
β-strand	170-178	9	5
β-strand	181-191	11	5
β-strand	201-206	6	6
β-strand	211-215	5	6

Chain L: 10 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	7
β-strand	10-13	4	8
β-strand	19-25	7	7
β-strand	31-37	7	8
β-strand	44-48	5	8
β-strand	52-53	2	8
α-helix	54	1
β-strand	61-66	6	7
β-strand	69-74	6	7
α-helix	79-81	3
β-strand	84-90	7	8
α-helix	95	1
β-strand	96-97	2	8
β-strand	98	1	7
β-strand	101-105	5	8
α-helix	106	1
β-strand	110	1	9
α-helix	111-112	2
β-strand	113-117	5	10
α-helix	118-120	3
α-helix	121-126	6
β-strand	128-138	11	10
β-strand	139	1	9
β-strand	143-149	7	11
β-strand	152-154	3	11
β-strand	158-162	5	10
α-helix	163-166	4
β-strand	172-181	10	10
α-helix	182-185	4
β-strand	190-197	8	11
α-helix	203	1
β-strand	204-209	6	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Type-2 angiotensin II receptor	A	protein	312	Homo sapiens	P50052 (AlphaFold model)
Angiotensin II	B	protein	8	Homo sapiens	P01019 (AlphaFold model)
Soluble cytochrome b562,Soluble cytochrome b562	C	protein	86	Escherichia coli	P0ABE7 (AlphaFold model)
Heavy chain of 4A03Fab	H	protein	220	Mus musculus
Light chain of 4A03Fab	L	protein	212	Mus musculus

Sequence of entity 1 (A), FASTA

>6JOD_1 Type-2 angiotensin II receptor (chains A)
CSQKPSDKHLDAIPILYYIIFVIGFLVNIVVVTLFCCQKGPKKVSSIYIFNLAVADLLLL
ATLPLWATYYSYRYDWLFGPVMCKVFGSFLTLNMFASIFFITCMSVDRYQSVIYPFLSQR
RNPWQASYIVPLVWCMACLSSLPTFYFRDVRTIEYLGVNACIMAFPPEKYAQWAAGIALM
KNILGFIIPLIFIATCYFGIRKHLLKTNSYGKNRITRDQVLKMAAAVVLAFIICWLPFHV
LTFLDALAWMGVINSCEVIAVIDLALPFAILLGFTNSCVNPFLYCFVGNRFQQKLRSVFR
VPITWLQGKRES

Sequence of entity 2 (B), FASTA

>6JOD_2 Angiotensin II (chains B)
DRVYIHPF

Sequence of entity 3 (C), FASTA

>6JOD_3 Soluble cytochrome b562,Soluble cytochrome b562 (chains C)
ADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAGSGSGDILVGQIDDALKLAN
EGKVKEAQAAAEQLKTTINAYIQKYG

Sequence of entity 4 (H), FASTA

>6JOD_4 Heavy chain of 4A03Fab (chains H)
DVQLVESGGGLVQPGGSRKLSCAASGFTFSGFGMHWVRQAPEKGLEWVAYISSGSSLIYY
ADTVKGRFTISRDNPKNTLFLQMTSLRSEDTAMYFCATSLYYGTPWFAYWGQGTLVTVSA
AKTTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSG
LYTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLEPS

Sequence of entity 5 (L), FASTA

>6JOD_5 Light chain of 4A03Fab (chains L)
DIVLTQSPAIMSASPGEKVTMTCSASSSVTYMYWYQQKPGSSPRLLIYDTSNLASGVPVR
FSGSGSGTSYSLTISRMEAEDAATFYCQQWSSYPLTFGAGTKLELKRADAAPTVSIFPPS
SEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTL
TKDEYERHNSYTCEATHKTSTSPIVKSFNRNE

Primary citation

The Crystal Structure of Angiotensin II Type 2 Receptor with Endogenous Peptide Hormone. Asada, H., Inoue, A., Ngako Kadji, F.M. et al. Structure (2020) 28:418. DOI 10.1016/j.str.2019.12.003 · PubMed

Other PDB entries of the same protein (UniProt P50052 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5UNF 2.8 Å, XFEL structure of human angiotensin II type 2 receptor (Monoclinic form) in complex with…
5UNG 2.8 Å, XFEL structure of human angiotensin II type 2 receptor (Orthorhombic form) in complex…
5UNH 2.9 Å, Synchrotron structure of human angiotensin II type 2 receptor in complex with compound 2…
7JNI 3.0 Å, Crystal structure of the angiotensin II type 2 receptoror (AT2R) in complex with EMA401
5XJM 3.2 Å, Complex structure of angiotensin II type 2 receptor with Fab
7C6A 3.4 Å, Crystal structure of AT2R-BRIL and SRP2070_Fab complex

Browse structure collections

About this viewer

MolViewer shows 6JOD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.