6JZC: Tubulin detyrosination

Structural basis of tubulin detyrosination. Determined by X-ray diffraction at 2.2 Å resolution. Released 17 Jul 2019.

Method: X-ray diffraction
Resolution: 2.2 Å
Organisms: Mus musculus, Homo sapiens
Chains: 4
Atoms: 5,020
Mol. weight: 102.57 kDa
Released: 17 Jul 2019

Explore 6JZC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6JZC contains 31 α-helices and 20 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	50-51	2	1
α-helix	58-59	2
α-helix	60-73	14
α-helix	77-84	8
α-helix	90-94	5
α-helix	96-99	4
α-helix	107-121	15
β-strand	123	1	2
β-strand	128-129	2	1
α-helix	139-152	14
β-strand	156	1	2
α-helix	158-169	12
β-strand	176-186	11	3
β-strand	189-200	12	3
β-strand	203-207	5	3
α-helix	213-215	3
β-strand	218-222	5	3
α-helix	225-237	13
α-helix	241	1
β-strand	242-248	7	3
α-helix	250-253	4
β-strand	267-269	3	3
α-helix	271-273	3
α-helix	276-291	16
α-helix	295-297	3

Chain B: 14 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	50-51	2	4
α-helix	58-59	2
α-helix	60-73	14
α-helix	77-85	9
α-helix	93-99	7
α-helix	107-121	15
β-strand	123	1	5
β-strand	128-129	2	4
α-helix	139-152	14
β-strand	156	1	5
α-helix	158-169	12
β-strand	176-186	11	6
β-strand	189-200	12	6
β-strand	203-207	5	6
β-strand	218-222	5	6
α-helix	225-237	13
α-helix	241	1
β-strand	242-248	7	6
α-helix	250-253	4
α-helix	260-263	4
β-strand	267-269	3	6
α-helix	271-273	3
α-helix	276-292	17
α-helix	295-297	3

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	27-59	33

Chain D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	29-59	31

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tubulinyl-Tyr carboxypeptidase 2	A, B	protein	355	Mus musculus	Q8C5G2 (AlphaFold model)
Small vasohibin-binding protein	C, D	protein	88	Homo sapiens	Q8N300 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6JZC_1 Tubulinyl-Tyr carboxypeptidase 2 (chains A, B)
MTGSAADTHRCPHPKITKGTRSRSSHARPVSLATSGGSEEEDKDGGVLFHVNKSGFPIDS
HTWERMWLHVAKVHPRGGEMVGAIRNAAFLAKPSIPQVPNYRLSMTIPDWLQAIQNYMKT
LQYNHTGTQFFEIRKMRPLSGLMETAKEMTRESLPIKCLEAVILGIYLTNGQPSIERFPI
SFKTYFSGNYFHHVVLGIYCNGYYGSLGMSRRAELMDKPLTFRTLSDLVFDFEDSYKKYL
HTVKKVKIGLYVPHEPHSFQPIEWKQLVLNVSKMLRADIRKELEKYARDMRMKILKPASA
HSPTQVRSRGKSLSPRRRQASPPRRLGRRDKSPALTEKKVADLGTLNEVGYQIRI

Sequence of entity 2 (C, D), FASTA

>6JZC_2 Small vasohibin-binding protein (chains C, D)
MHHHHHHHHHHSGDEVDAGSGHMDPPARKEKTKVKESVSRVEKAKQKSAQQELKQRQRAE
IYALNRVMTELEQQQFDEFCKQMQPPGE

Primary citation

Structural basis of tubulin detyrosination by VASH2/SVBP heterodimer. Zhou, C., Yan, L., Zhang, W.H. et al. Nat Commun (2019) 10:3212-3212. DOI 10.1038/s41467-019-11277-8 · PubMed

Other PDB entries of the same protein (UniProt Q8C5G2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6JZD 2.48 Å, Crystal structure of peptide-bound VASH2-SVBP complex
6JZE 2.51 Å, Crystal structure of VASH2-SVBP complex with the magic triangle I3C

Browse structure collections

About this viewer

MolViewer shows 6JZC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.