6K01: XH2A-H2B

Crystal structure of xH2A-H2B. Determined by X-ray diffraction at 2.84 Å resolution. Released 9 Oct 2019.

Method: X-ray diffraction
Resolution: 2.84 Å
Organism: Xenopus laevis
Chains: 2
Atoms: 1,280
Mol. weight: 21.31 kDa
Released: 9 Oct 2019

Explore 6K01 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6K01 contains 8 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain C: 4 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	28-37	10
β-strand	43-44	2	1
α-helix	47-72	26
β-strand	78-79	2	2
α-helix	81-89	9
α-helix	92-97	6

Chain D: 4 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	36-46	11
β-strand	51-52	2	2
α-helix	54-81	28
β-strand	86-87	2	1
α-helix	89-99	11
α-helix	103-116	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Histone H2A	C	protein	92	Xenopus laevis	Q6AZJ8 (AlphaFold model)
Histone H2B 1.1	D	protein	99	Xenopus laevis	P02281 (AlphaFold model)

Sequence of entity 1 (C), FASTA

>6K01_1 Histone H2A (chains C)
AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDN
KKTRIIPRHLQLAVRNDEELNKLLGRVTIAQG

Sequence of entity 2 (D), FASTA

>6K01_2 Histone H2B 1.1 (chains D)
KKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKR
STITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK

Primary citation

Crystal structure of xlH2A-H2B. Liu, Y.R. Structure (2019).

Other PDB entries of the same protein (UniProt Q6AZJ8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8RUQ 2.29 Å, Borealin N-terminus in complex with H3.T3p-nucleosome
3MGR 2.3 Å, Binding of Rubidium ions to the Nucleosome Core Particle
8G86 2.3 Å, Human Oct4 bound to nucleosome with human nMatn1 sequence (focused refinement of…
8G88 2.3 Å, Human Oct4 bound to nucleosome with human nMatn1 sequence
9RXU 2.3 Å, RAPTA-C (Ruthenium[II]-cymene-phosphaadamantane) cancer drug binding to the nucleosome…
4KHA 2.35 Å, Structural basis of histone H2A-H2B recognition by the essential chaperone FACT
6YN1 2.35 Å, Crystal structure of histone chaperone APLF acidic domain bound to the histone…
9WC0 2.4 Å, The structure of NCP-RA module of ncBAF-nucleosome complex
3MGP 2.44 Å, Binding of Cobalt ions to the Nucleosome Core Particle
3LZ0 2.5 Å, Crystal Structure of Nucleosome Core Particle Composed of the Widom 601 DNA Sequence…
3LZ1 2.5 Å, Crystal Structure of Nucleosome Core Particle Composed of the Widom 601 DNA Sequence…
9N6H 2.54 Å, 2.54 A S.cerevisiae Chd1[L886G/L889G/L891G]-nucleosome 1:1 complex

Browse structure collections

About this viewer

MolViewer shows 6K01 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.