X-ray structure of human PPARalpha ligand binding domain-intrinsic fatty acid (E. coli origin) co-crystals obtained by cross-seeding. Determined by X-ray diffraction at 1.23 Å resolution. Released 11 Nov 2020.
Explore 6KAX in 3D Show helices and sheets RCSB PDB PDBe
6KAX contains 19 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 201-217 | 17 | |
| α-helix | 222-230 | 9 | |
| α-helix | 237-238 | 2 | |
| β-strand | 239-241 | 3 | 1 |
| α-helix | 244-254 | 11 | |
| α-helix | 256-259 | 4 | |
| α-helix | 262-264 | 3 | |
| α-helix | 266-267 | 2 | |
| α-helix | 268-291 | 24 | |
| α-helix | 302-321 | 20 | |
| α-helix | 322-324 | 3 | |
| β-strand | 325-326 | 2 | 1 |
| β-strand | 329-332 | 4 | 1 |
| β-strand | 337-340 | 4 | 1 |
| α-helix | 341-346 | 6 | |
| α-helix | 348 | 1 | |
| α-helix | 351-353 | 3 | |
| α-helix | 356-367 | 12 | |
| α-helix | 372-383 | 12 | |
| α-helix | 394-415 | 22 | |
| α-helix | 422-450 | 29 | |
| α-helix | 455-457 | 3 | |
| α-helix | 458-464 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Peroxisome proliferator-activated receptor alpha | A | protein | 273 | Homo sapiens | Q07869 (AlphaFold model) |
>6KAX_1 Peroxisome proliferator-activated receptor alpha (chains A) GSHMTADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPPFVIHDMETLCMAEKTLV AKLVANGIQNKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANLDLNDQVTLLKYGVYE AIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFDFAMKFNALELDDSDI SLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDIFLFPKLLQKMADLRQ LVTEHAQLVQIIKKTESDAALHPLLQEIYRDMY
| ID | Name | Formula | Copies |
|---|---|---|---|
| PLM | Palmitic acid | C16 H32 O2 | 1 |
Water and common crystallization additives (GOL) are not listed.
PPAR alpha Ligand-Binding Domain Structures with Endogenous Fatty Acids and Fibrates. Kamata, S., Oyama, T., Saito, K. et al. iScience (2020) 23:101727-101727. DOI 10.1016/j.isci.2020.101727 · PubMed
Other PDB entries of the same protein (UniProt Q07869 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6KAX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.